Advanced Search



Anti-SFTPC antibody produced in rabbit

SIGMA/HPA010928 - Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab1

Synonym: Anti-BRICD6; Anti-PSP-C; Anti-SFTP2; Anti-SMDP2; Anti-SP-C

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-HPA010928-100UL 100 µL
$607.00
1/EA
Add To Favorites
Enhanced Validation-Orthogonal RNAseq Confirmation Immunohistochemistry analysis in human lung and kidney tissues using HPA010928 antibody. Corresponding SFTPC RNA-seq data are presented for the same tissues.
Immunohistochemistry Immunohistochemical staining of human lung shows moderate to strong cytoplasmic positivity in respiratory epithelial cells.
Immunohistochemistry Immunohistochemical staining of human kidney shows no positivity in cells in glomeruli as expected.
Western Blotting Western blot analysis in human lung tissue.
Prestige Antibodies® Highly characterized and Enhanced Validated antibodies

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
conjugate unconjugated
enhanced validation orthogonal RNAseq
Learn more about Antibody Enhanced Validation 
form buffered aqueous glycerol solution
immunogen sequence PEAQQRLALSEHLVTTATFSIGSTGLVVYDYQQLLIAYKPAPGTCCYIMKIAPESIPSLEALTRKVHNFQAKPAVPTSKLGQAEGRDAGSAPSGGDPAFLGMAVSTLCG
product line Prestige Antibodies® Powered by Atlas Antibodies
Quality Level 100 
shipped in wet ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunoblotting: 0.04-0.4 μg/mL
  immunohistochemistry: 1:2500-1:5000
UniProt accession no. P11686 
Application: Anti-SFTPC antibody produced in rabbit has been used in immunohistochemistry (IHC) and immunofluorescence (IF).
Biochem/physiol Actions: SFTPC (surfactant protein C) stabilizes the pulmonary surfactant film and aids in the adsorption of phospholipids on the surfactant monolayer. This way it regulates the metabolism and dynamics of the phospholipids constituting pulmonary surfactant. Mutations in this gene are associated with interstitial lung disease (ILD) in infants. Mutations in SFTPC can lead to various disorders such as, chronic pneumonitis in infants, and usual or desquamative interstitial pneumonia and idiopathic pulmonary fibrosis in adults. G100S mutation in the BRICHOS domain of SFTPC proprotein, leads to increased endoplasmic reticulum (ER) stress and cell apoptosis. Therefore, G100S mutation in this gene is involved in the pathogenesis of familial pulmonary fibrosis in Japanese population. Mutations in SFTPC gene also result in combined pulmonary fibrosis and emphysema (CPFE) syndrome, which is characterized by emphysema, inflammation and fibrosis.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Features and Benefits: Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.
General description: Pulmonary surfactant is a mixture of phospholipids and protein, which is surface-active and secreted by type II epithelial cells into the alveolar space. There are four proteins present in the surfactant namely, SP (surfactant protein)-A, SP-B, SP-C or SFTPC and SP-D. SFTPC is a hydrophobic protein, which is produced as a proprotein and undergoes post-translational modification to have its NH2 and COOH propeptides removed. The mature active protein has a molecular weight of 3.7kDa. The proprotein is composed of 197 amino acids and is produced exclusively by alveolar type 2 (AT2) cells. SFTPC contains BRICHOS domain, which is suggested to prevent the aggregation of the peptide and regulate proteolytic processing of SFTPC proprotein. This gene is located on human chromosome 8p21.
Immunogen: Pulmonary surfactant-associated protein C Precursor recombinant protein epitope signature tag (PrEST)
Legal Information: Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Other Notes: Corresponding Antigen APREST72206
Physical form: Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
RIDADR NONH for all modes of transport
WGK Germany WGK 1
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top