Advanced Search



Anti-LETM1 antibody produced in rabbit

SIGMA/HPA011029 - Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym: Anti-Leucine zipper-EF-hand-containing transmembrane protein 1, mitochondrial precursor

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-HPA011029-100UL 100 µL
$667.00
1/EA
Add To Favorites
Enhanced Validation-Orthogonal RNAseq Confirmation Immunohistochemistry analysis in human colon and pancreas tissues using Anti-LETM1 antibody. Corresponding LETM1 RNA-seq data are presented for the same tissues.
Immunohistochemistry Immunohistochemical staining of human colon shows high expression.
Immunohistochemistry Immunohistochemical staining of human pancreas shows low expression as expected.
Immunofluorescence Immunofluorescent staining of human cell line U-251 MG shows localization to mitochondria.
Western Blotting Western blot analysis in human cell line MOLT-4.
Prestige Antibodies® Highly characterized and Enhanced Validated antibodies

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
conjugate unconjugated
enhanced validation orthogonal RNAseq
Learn more about Antibody Enhanced Validation 
form buffered aqueous glycerol solution
immunogen sequence SKTGEEKYVEESKASKRLTKRVQQMIGQIDGLISQLEMDQQAGKLAPANGMPTGENVISVAELINAMKQVKHIPESKLTSLAAALDENKDGKVNIDDLVKVIELVDKEDVHISTSQVAEIVATLE
product line Prestige Antibodies® Powered by Atlas Antibodies
Quality Level 100 
shipped in wet ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunoblotting: 0.04-0.4 μg/mL
  immunofluorescence: 0.25-2 μg/mL
  immunohistochemistry: 1:200-1:500
UniProt accession no. O95202 
Application: Anti-LETM1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project  . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols  and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige .
Biochem/physiol Actions: LETM1 (Leucine zipper-EF-hand containing transmembrane protein 1) is responsible for maintaining the shape and volume of mitochondria. It plays a part in mitochondrial translation machinery and mitochondrial biogenesis. It regulates the buffering of mitochondria by controlling Ca2+/H+ antiporter, and also regulates K+/H+ ion exchange. Inactivation of this gene is associated with Wolf-Hirschhorn syndrome, where it leads to aberration in mitochondrial functionality. It is responsible for growth and motor delay, as well as seizures which characterize Wolf-Hirschhorn syndrome. It is up-regulated in various human cancers, and is involved in the tumorigenesis of head and neck squamous cell carcinoma (HNSCC). It also predicts poor prognosis in HNSCC. Up-regulation of this gene leads to suppressed mitochondrial biogenesis and ATP synthesis, leading to necrotic cell death.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Features and Benefits: Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.
General description: LETM1 (Leucine zipper-EF-hand containing transmembrane protein 1) is a mitochondrial inner membrane protein, and is homologous to yeast protein Mdm38p. It was originally recognized as one of the genes deleted in Wolf-Hirschhorn syndrome. It is a transmembrane protein, which has 14-3-3-like domain in its soluble region, two EF hand Ca2+-binding motifs and two coiled-coil domains. The C-terminal of this protein is hydrophilic and faces the matrix, whereas the N-terminal is hydrophobic and spans the membrane. It has a molecular weight of 83.4kDa. This gene is located on human chromosome 4p16.3.
Immunogen: LETM1 and EF-hand domain-containing protein 1, mitochondrial Precursor (Leucine zipper-EF-hand-containing transmembrane protein 1)
Legal Information: Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Other Notes: Corresponding Antigen APREST72188
Physical form: Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
RIDADR NONH for all modes of transport
WGK Germany WGK 1
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top