Advanced Search



Anti-ANXA1 antibody produced in rabbit

SIGMA/HPA011271 - Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym: Anti-Annexin A1; Anti-Annexin I; Anti-Annexin-1; Anti-Calpactin II; Anti-Chromobindin-9; Anti-Lipocortin I; Anti-Phospholipase A2 inhibitory protein; Anti-p35

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-HPA011271-100UL 100 µL
$573.00
1/EA
Add To Favorites
Enhanced Validation-By Independent Antibodies Immunohistochemical staining of human colon, esophagus, lung and lymph node using Anti-ANXA1 antibody HPA011271 (A) shows similar protein distribution across tissues to independent antibody HPA011272 (B).
Enhanced Validation-Orthogonal RNAseq Confirmation Immunohistochemistry analysis in human esophagus and cerebral cortex tissues using HPA011271 antibody. Corresponding ANXA1 RNA-seq data are presented for the same tissues.
Enhanced Validation-RNAi Knockdown Western blot analysis in U-251MG cells transfected with control siRNA, target specific siRNA probes 1 and 2, using Anti-ANXA1 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.
Enhanced Validation-By Independent Antibodies Western blot analysis using Anti-ANXA1 antibody HPA011271 (A) shows similar pattern to independent antibody HPA011272 (B).
Immunohistochemistry Immunohistochemical staining of human esophagus shows moderate to strong positivity in squamous epithelial cells.
Immunohistochemistry Immunohistochemical staining of human cerebral cortex shows no positivity in neurons as expected.
Immunohistochemistry Immunohistochemical staining of human colon shows moderate positivity in lymphoid cells.
Immunohistochemistry Immunohistochemical staining of human lung shows strong positivity in macrophages.
Immunohistochemistry Immunohistochemical staining of human lymph node shows moderate to strong positivity in non-germinal center cells.
Immunofluorescence Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, plasma membrane and cytosol.
Western Blotting Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Prestige Antibodies® Highly characterized and Enhanced Validated antibodies

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
conjugate unconjugated
enhanced validation orthogonal RNAseq
independent
RNAi knockdown
Learn more about Antibody Enhanced Validation 
form buffered aqueous glycerol solution
immunogen sequence FRNALLSLAKGDRSEDFGVNEDLADSDARALYEAGERRKGTDVNVFNTILTTRSYPQLRRVFQKYTKYSKHDMNKVLDLELKGDIEKCLTAIVKCATSKPAFFAEKLHQAMKGVGTRHKALIRIMV
product line Prestige Antibodies® Powered by Atlas Antibodies
Quality Level 100 
shipped in wet ice
species reactivity mouse, rat, human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunoblotting: 0.04-0.4 μg/mL
  immunofluorescence: 0.25-2 μg/mL
  immunohistochemistry: 1:1000-1:2500
UniProt accession no. P04083 
Application: Anti-ANXA1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project  . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols  and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige .
Biochem/physiol Actions: Annexin A1 (ANXA1) is involved in multiple cellular functions such as, cell proliferation and differentiation and signal transduction. Its expression is deregulated in various cancers such as, glial tumors, nasopharyngeal carcinoma, head and neck, larynx, esophageal, breast, hepatocellular, gastric, prostate and pancreatic cancer. It is up-regulated in rectal cancer and predicts poor prognostic response to concurrent chemoradiotherapy. ANXA1 is involved in anti-inflammatory processes, and regulates apoptosis and phagocytosis of apoptotic bodies. Its expression levels are altered in cystic fibrosis, and might be involved in the pathogenesis of glomerular disorders. It has potential as a marker for the diagnosis and prognosis of glomerular disorders. ANXA1 has a high level of expression in normal gastrointestinal epithelium, and might be involved in the maintenance of cellular boundaries. It also regulates gastric cancer cell proliferation and viability through COX2 (cyclooxygenase 2) pathway.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Features and Benefits: Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.
General description: Annexin A1 (ANXA1) belongs to the annexin gene family and is a part of the A subfamily. It is a glucocorticoid-regulated, calcium and phospholipid-binding protein. This protein has a molecular weight of 37kDa.
Immunogen: Annexin A1 recombinant protein epitope signature tag (PrEST)
Legal Information: Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Other Notes: Corresponding Antigen APREST71575
Physical form: Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
RIDADR NONH for all modes of transport
WGK Germany WGK 1
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top