Advanced Search



Anti-NECAB2 antibody produced in rabbit

SIGMA/HPA013998 - affinity isolated antibody, buffered aqueous glycerol solution

Synonym: Anti-EF-hand calcium-binding protein 2; Anti-EFCBP2 antibody produced in rabbit; Anti-N-terminal EF-hand calcium-binding protein 2; Anti-Neuronal calcium-binding protein 2; Anti-Stip-2; Anti-Synaptotagmin-interacting protein 2

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-HPA013998-100UL 100 µL
$667.00
1/EA
Add To Favorites
Enhanced Validation-By Independent Antibodies Immunohistochemical staining of human cerebral cortex, kidney, pancreas and skin using Anti-NECAB2 antibody HPA013998 (A) shows similar protein distribution across tissues to independent antibody HPA014144 (B).
Enhanced Validation-Orthogonal RNAseq Confirmation Immunohistochemistry analysis in human cerebral cortex and skin tissues using HPA013998 antibody. Corresponding NECAB2 RNA-seq data are presented for the same tissues.
Immunohistochemistry Immunofluorescence staining of mouse facial nucleus shows distinct positivity in neuronal cell bodies and processes.
Immunohistochemistry Immunofluorescence staining of mouse midbrain shows neuronal positivity in dorsal raphe.
Immunohistochemistry Immunofluorescence staining of mouse caudate putamen shows immunoreactivity in medium spiny neurons and synapses.
Immunohistochemistry Immunofluorescence staining of mouse hippocampus shows immunoreactivity in a subset of neurons,
Immunohistochemistry Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in a subset of neurons, as well as moderate positivity in neuropil.
Immunohistochemistry Immunohistochemical staining of human pancreas shows weak cytoplasmic positivity in islets of Langerhans.
Immunohistochemistry Immunohistochemical staining of human skin shows no positivity in squamous epithelial cells as expected.
Immunohistochemistry Immunohistochemical staining of human kidney showsno positivity in cells in tubules as expected.
Immunofluorescence Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.
Western Blotting Western blot analysis in human cerebral cortex tissue.
Western Blotting Western blot analysis in mouse cerebral cortex tissue.

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
conjugate unconjugated
enhanced validation independent
Learn more about Antibody Enhanced Validation 
form buffered aqueous glycerol solution
immunogen sequence VILDIFRRADKNDDGKLSLEEFQLFFADGVLNEKELEDLFHTIDSDNTNHVDTKELCDYFVDHMGDYEDVLASLETLNHSVLKAMGYTKKVYEGGSNVDQFVTRFLLKETANQIQSLLSSVESAVEAIEEQTSQL
Quality Level 100 
shipped in wet ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunoblotting: 0.04-0.4 μg/mL
  immunofluorescence: 0.25-2 μg/mL
  immunohistochemistry: 1:1000-1:2500
UniProt accession no. Q7Z6G3 
Application: Anti-NECAB2 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project  . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols  and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige .
Biochem/physiol Actions: The gene NECAB2 (N-terminal EF-hand calcium binding protein 2) encodes a neuronal calcium binding protein that is capable of binding to the C-terminal domain of the adenosine A2A receptor. This binding modulates cell surface expression of the receptor, the ligand-dependent internalization and the receptor-mediated activation of the MAPK (Mitogen-activated protein kinase) pathway.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Features and Benefits: Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.
General description: The gene NECAB2 (N-terminal EF-hand calcium binding protein 2) encodes a member of the NECAB family of proteins containing an N-terminal EF-hand domain involved in binding of Ca2+. The EF-hand domain contains a single site that binds to calcium and is located next to a NHR domain that contains a coiled-coil domain. The N-terminus contains a bacterial domain called the DUF176 or ABM motif with unknown function. In rats, it is predominantly expressed in the brain.
Immunogen: N-terminal EF-hand calcium-binding protein 2 recombinant protein epitope signature tag (PrEST)
Legal Information: Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Other Notes: Corresponding Antigen APREST72715
Physical form: Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
RIDADR NONH for all modes of transport
WGK Germany WGK 1
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top