Advanced Search



Anti-ITPR1 antibody produced in rabbit

SIGMA/HPA014765 - Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym: Anti-ACV; Anti-IP3R1; Anti-Insp3r1; Anti-PPP1R94; Anti-SCA15; Anti-SCA16; Anti-SCA29

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-HPA014765-100UL 100 µL
$607.00
1/EA
Add To Favorites
Immunohistochemistry Immunohistochemical staining of human cerebral cortex shows weak to moderate cytoplasmic positivity in neurons.
Immunohistochemistry Immunohistochemical staining of human cerebellum shows moderate to strong cytoplasmic positivity in Purkinje cells.
Immunohistochemistry Immunohistochemical staining of human placenta shows no positivity in trophoblastic cells as expected.
Immunohistochemistry Immunohistochemical staining of human skin shows no positivity in epidermal cells as expected.
Western Blotting Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Human cell line U-87 MG

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
conjugate unconjugated
form buffered aqueous glycerol solution
immunogen sequence KDDFILEVDRLPNETAVPETGESLASEFLFSDVCRVESGENCSSPAPREELVPAEETEQDKEHTCETLLMCIVTVLSHGLRS
product line Prestige Antibodies® Powered by Atlas Antibodies
Quality Level 100 
shipped in wet ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunoblotting: 0.04-0.4 μg/mL
  immunohistochemistry: 1:500-1:1000
UniProt accession no. Q14643 
Application: All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project  and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols   and other useful information.
Biochem/physiol Actions: ITPR1 (inositol 1,4,5-trisphosphate receptor, type 1) is a Ca2+-channel, which is activated upon binding by inositol 1,4,5-trisphosphate (IP3), and releases Ca2+ from endoplasmic reticulum (ER) into the cytoplasm. This released calcium participates in various Ca2+-dependent signaling and cellular processes. It is activated on death receptor binding or cellular damage, and regulates intracellular calcium levels during apoptosis. Heterozygous deletion in this gene is responsible for the autosomal dominant neurodegenerative disorder spinocerebellar ataxia type 15 (SCA15), which is characterized by late-onset, slow-progressive cerebellar ataxia. It is involved in the activation of T-cells, where it gets phosphorylated at Y353 residue, located at the IP3-binding domain. It plays an essential role in the initial stages of myoblast differentiation, where it induces the expression of myogenin and MEF2 (myocyte enhancer factor 2), which are transcription factors specific to muscles. ITPR1 is also essential for development and maintenance of cerebellum.
Features and Benefits: Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.
General description: ITPR1 (inositol 1,4,5-trisphosphate receptor, type 1) is a ligand-gated calcium channel, which is present in the endoplasmic reticulum (ER). It either acts as a homotetarmer or forms heterotetramer with type 2 or type 3 inositol 1,4,5-trisphosphate receptors. It is highly expressed in the central nervous system, especially in the Purkinje cells of the cerebellum. This channel contains a coupling/regulatory domain, which consists of phosphorylation sites, a proteolytic cleavage region, ATP-binding sites, and binding sites for multiple proteins. This gene is localized to human chromosome 3p26.
Immunogen: Inositol 1,4,5-trisphosphate receptor type 1 recombinant protein epitope signature tag (PrEST)
Legal Information: Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Other Notes: Corresponding Antigen APREST73267
Physical form: Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
RIDADR NONH for all modes of transport
WGK Germany WGK 1
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top