Advanced Search



Anti-MTDH antibody produced in rabbit

SIGMA/HPA015104 - Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym: Anti-3D3/lyric antibody produced in rabbit; Anti-AEG-1 antibody produced in rabbit; Anti-Astrocyte elevated gene-1 protein antibody produced in rabbit; Anti-Lysine-rich CEACAM1 co-isolated protein antibody produced in rabbit; Anti-Metadherin antibody produced in rabbit; Anti-Metastasis adhesion protein antibody produced in rabbit; Anti-Protein LYRIC antibody produced in rabbit

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-HPA015104-100UL 100 µL
$607.00
1/EA
Add To Favorites
Enhanced Validation-By Independent Antibodies Western blot analysis using Anti-MTDH antibody HPA015104 (A) shows similar pattern to independent antibody HPA010932 (B).
Immunohistochemistry Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.
Immunohistochemistry Immunohistochemical staining of human cerebellum shows moderate to strong cytoplasmic positivity in purkinje cells.
Immunohistochemistry Immunohistochemical staining of human tonsil shows moderate to strong cytoplasmic positivity in non - germinal center cells.
Immunohistochemistry Immunohistochemical staining of human placenta shows moderate to strong cytoplasmic positivity in decidual cells.
Immunofluorescence Immunofluorescent staining of human cell line A-431 shows localization to endoplasmic reticulum.

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
conjugate unconjugated
enhanced validation independent
Learn more about Antibody Enhanced Validation 
form buffered aqueous glycerol solution
immunogen sequence NSSRHDGKEVDEGAWETKISHREKRQQRKRDKVLTDSGSLDSTIPGIENTITVTTEQLTTASFPVGSKKNKGDSHLNVQVSNFKSGKGDSTLQVSSGLNENLTVNGGGWNEKSVKLSSQISAGEEKWNSVSPA
product line Prestige Antibodies® Powered by Atlas Antibodies
Quality Level 100 
shipped in wet ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunoblotting: 0.04-0.4 μg/mL
  immunofluorescence: 0.25-2 μg/mL
  immunohistochemistry: 1:200-1:500
UniProt accession no. Q86UE4 
Application: Anti-MTDH antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project  . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols  and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige .
Biochem/physiol Actions: MTDH (metadherin) is highly expressed in multiple cancers such as, esophageal squamous cell carcinoma, hepatocellular carcinoma (HCC), breast, gastric, renal, prostate, colorectal cancer, non-small cell lung cancer, and glioma. It promotes angiogenesis, autophagy, tumor invasion and metastasis. It is responsible for resistance to chemotherapy and tamoxifen, and its up-regulation in invasive breast cancer is related to poor prognosis. In HER2+ breast cancer, it is responsible for resistance to trastuzumab. It chromosomal location is a susceptibility locus to migraine, and thus, this gene might be associated to migraine. It is up-regulated in astrocytomas, and higher the expression level, higher the grade of astrocytoma. Thus, this protein has potential as diagnostic and prognostic marker for astrocytomas. It is essential for the tumorigenesis of hepatocellular carcinoma (HCC), via the activation of NF-κB.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Features and Benefits: Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.
General description: MTDH (metadherin) is a transmembrane protein, which spans the membrane once, and has a molecular weight of 64kDa. It is also called astrocyte elevated gene-1 (AEG-1) and lysine-rich CEACAM1 coisolated (LYRIC). It was initially isolated from primary human fetal astrocytes, as a transcript induced by human immunodeficiency virus (HIV)-1. This gene is localized to human chromosome 8q22.1, and is expressed in human brain, with higher expression in neurons as compared to glial cells. This gene has 12 exons and 11 introns.
Immunogen: Protein LYRIC recombinant protein epitope signature tag (PrEST)
Legal Information: Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Other Notes: Corresponding Antigen APREST72055
Physical form: Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
RIDADR NONH for all modes of transport
WGK Germany WGK 1
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top