Advanced Search



Anti-DNAJB11 antibody produced in rabbit

SIGMA/HPA017051 - Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym: Anti-DnaJ homolog subfamily B member 11 precursor antibody produced in rabbit; Anti-ER-associated Hsp40 co-chaperone antibody produced in rabbit; Anti-ER-associated dnaJ protein 3 antibody produced in rabbit; Anti-ErJ3 antibody produced in rabbit; Anti-PWP1-interacting protein 4 antibody produced in rabbit; Anti-hDj9 antibody produced in rabbit

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-HPA017051-100UL 100 µL
$667.00
1/EA
Add To Favorites
By Recombinant Expression Western Blotting. Western blot analysis in control (vector only transfected HEK293T lysate) and DNAJB11 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY402537).
Immunohistochemistry Immunohistochemical staining of human placenta shows moderate to strong cytoplasmic positivity in trophoblastic cells.
Immunohistochemistry Immunohistochemical staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.
Immunohistochemistry Immunohistochemical staining of human testis shows weak to moderate cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry Immunohistochemical staining of human fallopian tube shows moderate to strong cytoplasmic positivity in glandular cells.

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
conjugate unconjugated
enhanced validation recombinant expression
Learn more about Antibody Enhanced Validation 
form buffered aqueous glycerol solution
immunogen sequence DSEKRKQYDTYGEEGLKDGHQSSHGDIFSHFFGDFGFMFGGTPRQQDRNIPRGSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVCDECPNVKLVNEERTLEV
product line Prestige Antibodies® Powered by Atlas Antibodies
Quality Level 100 
shipped in wet ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunoblotting: 0.04-0.4 μg/mL
  immunohistochemistry: 1:20-1:50
UniProt accession no. Q9UBS4 
Application: Anti-DNAJB11 antibody is suitable for immunoprecipitation.
Anti-DNAJB11 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project  . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols  and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige .
Biochem/physiol Actions: DNAJB11 (DnaJ (Hsp40) homolog, subfamily B, member 11) is a component of unassembled immunoglobulin (Ig) heavy chain: BiP (binding immunoglobulin protein) complex, where it acts as a co-factor for BiP, and helps in folding and assembly of proteins. It plays a major role in mammalian cell resistance to vero toxin. It is also involved in ER (endoplasmic reticulum) stress tolerance. It is secreted in the extracellular space, where it binds to mis-folded proteins and prevents their aggregation. It also reduces the toxicity of disease-related prion protein. DNAJB11 is involved in the intoxication pathway of cholera toxin.
Features and Benefits: Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.
General description: DNAJB11 (DnaJ (Hsp40) homolog, subfamily B, member 11) is a chaperone of the endoplasmic reticulum belonging to the endoplasmic reticulum (ER) Hsp40/DnaJ family. It is a component of quality control system of ER-associated degradation (ERAD). It contains the J domain, which is a highly conserved region made of 75 amino acids. It also shares certain domains with other HSP40 chaperones. These domains include a C-terminal domain, a glycine/phenylalanine-rich putative linker region and a cystine-rich domain. DNAJB11 is expressed ubiquitously, and has the highest expression in secretory tissues.
Immunogen: DnaJ homolog subfamily B member 11 precursor recombinant protein epitope signature tag (PrEST)
Legal Information: Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Other Notes: Corresponding Antigen APREST71693
Physical form: Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
RIDADR NONH for all modes of transport
WGK Germany WGK 1
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top