Anti-LRBA antibody produced in rabbit

SIGMA/HPA019366 - Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab1

Synonym: LRBA Antibody - Anti-LRBA antibody produced in rabbit; Lrba Antibody; Anti-Beige-like protein; Anti-CDC4-like protein; Anti-Lipopolysaccharide-responsive and beige-like anchor protein

Product Type: Chemical

Catalog Number	PKG Qty.	Price


45-HPA019366-100UL	100 µL	$607.00 1/EA	Add To Favorites

Immunohistochemistry Immunohistochemical staining of human prostate shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

Immunohistochemistry Immunohistochemical staining of human lymphoid tissues shows strong cytoplasmic positivity in a subset of germinal center cells.

Immunohistochemistry Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunofluorescence Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol and the Golgi apparatus.

Properties
Descriptions
Safety Info.
Basic Data

antibody form	affinity isolated antibody
antibody product type	primary antibodies
biological source	rabbit
clone	polyclonal
conjugate	unconjugated
form	buffered aqueous glycerol solution
immunogen sequence	SVLMVSKYRDILEPQNERHSQSCTETGSENENVSLSEITPAAFSTLTTASVEESESTSSARRRDSGIGEETATGLGSHVEVTPHTAPPGVSAGPDAISEVLSTLSLEVNKSPETKNDRGNDLDTKATPSVSV
product line	Prestige Antibodies^® Powered by Atlas Antibodies
Quality Level	100
shipped in	wet ice
species reactivity	human
storage temp.	−20°C
target post-translational modification	unmodified
technique(s)	immunofluorescence: 0.25-2 μg/mL
	immunohistochemistry: 1:200-1:500
UniProt accession no.	P50851

Application:	Anti-LRBA antibody produced in rabbit has been used: • in western blotting • fluorescence-activated cell sorting (FACS) • basic Local Alignment Search Tool (BLAST) analysis, • flow cytometry analysis
Application:	Anti-LRBA antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige .
Biochem/physiol Actions:	LRBA (lipopolysaccharide-responsive and beige-like anchor protein) participates in endocytosis of ligand-activated receptors. Mutations in LRBA are linked with inflammatory bowel disease (IBD)-like symptoms, autoimmune lymphoproliferative syndrome-like disease and IPEX (immune dysregulation, polyendocrinopathy, enteropathy, X-linked) syndrome.
Biochem/physiol Actions:	Lrba interacts with protein kinase A and modulates the intracellular vesicle trafficking to activated receptor complexes. This aids the secretion and membrane deposition of immune effector molecules, like cytotoxic T lymphocyte-associated antigen‐4 (CTLA4). The PH-like domain is critical for membrane association and WD-40 domain helps in ligand binding and signaling.
Disclaimer:	Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Features and Benefits:	Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section. Every Prestige Antibody is tested in the following ways: • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues. • Protein array of 364 human recombinant protein fragments.
General description:	Lrba consists of a BEACH domain situated between a PH-like domain and WD-40 domain.
General description:	The gene LRBA (lipopolysaccharide-responsive and beige-like anchor protein) is mapped to human chromosome 4q31.3. It belongs to the BEACH (beige and chediak-higashi)-WD40 (β-transducin) protein family. LRBA is ubiquitously expressed. The protein localizes in the cytoplasm. Upon activation of B cells, LRBA moves to the membrane of trans-Golgi network, lysosomes, endoplasmic reticulum and to the cell surface.
Immunogen:	Lipopolysaccharide-responsive and beige-like anchor protein recombinant protein epitope signature tag (PrEST)
Legal Information:	Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Other Notes:	Corresponding Antigen APREST74669
Physical form:	Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1

Storage Temp.	−20°C
UNSPSC	12352203

To Order From a Quote