Advanced Search



Anti-PRRX2 antibody produced in rabbit

SIGMA/HPA026808 - Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym: Anti-C17orf33; Anti-G-CSF; Anti-GCSF; Anti-MGC45931; Anti-PMX2; Anti-PRX2; Anti-paired related homeobox 2

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-HPA026808-100UL 100 µL
$667.00
1/EA
Add To Favorites
Immunohistochemistry JOURNAL CITATION: SPOCK1 Is a Novel Transforming Growth Factor-β:-Induced Myoepithelial Marker That Enhances Invasion and Correlates with Poor Prognosis in Breast Cancer. By: Fan, L. C., Jeng, Y. M., et al. in PLoS One, 2016. PubMed ID: 27626636 Image collected and cropped by CiteAb from the following publication, (http://dx.plos.org/10.1371/journal.pone.0162933), provided under a CC-BY license. Image might reflect a new usage that is not reflected in claims on product description or independently verified by Merck KGaA, Darmstadt, Germany. For Research Use Only. Not for use in diagnostic procedures.
ChIP-Exo-Seq composite graph for Anti-PRRX2 (HPA026808, Lot 000033259) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University. *Please note not all antibody batches are validated for use in ChIP applications.
Immunohistochemistry Immunohistochemical staining of human skin shows moderate nuclear positivity in squamous epithelial cells.
Immunohistochemistry Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
conjugate unconjugated
enhanced validation orthogonal RNAseq
Learn more about Antibody Enhanced Validation 
form buffered aqueous glycerol solution
immunogen sequence RAKFRRNERAMLASRSASLLKSYSQEAAIEQPVAPRPTALSPDYLSWTASSPYSTVPPYSPGSSGPATPGVNMANSIASLRLKAKEFSLHHSQVPTVN
product line Prestige Antibodies® Powered by Atlas Antibodies
Quality Level 100 
shipped in wet ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) ChIP: 1—10 μg (per reaction)
  immunohistochemistry: 1:200- 1:500
UniProt accession no. Q99811 
Application: All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project  . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols   and other useful information.
Application: Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper) 
Biochem/physiol Actions: Paired related homeobox 2 (PRRX2), along with homeobox B13(HOXB13), plays a vital role in scarless fetal skin regeneration. Mutations in the PRRX2 gene might lead to (NAFD) syndrome. Experimental studies on NIH-3T3cells (mouse embryonic fibroblast cell line) shows that conserved PRX domain of PRRX2 facilitates cell-specific and promoter-dependent transcriptional regulation. In rat, PRRX2 facilitates embryonic pituitary development by promoting vasculogenesis.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Features and Benefits: Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.
General description: Paired related homeobox 2 (PRRX2) is a member of PRRX gene family, which is encoded by a gene mapped to human chromosome 9q34.1. It is primarily expressed in proliferating fetal fibroblasts and developing dermis. Apart from this, reverse transcription polymerase chain reaction (RT-PCR) analysis of human tissue revealed the presence of PRRX2 in the kidney and lung.
Immunogen: paired related homeobox 2 recombinant protein epitope signature tag (PrEST)
Legal Information: Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Other Notes: Corresponding Antigen APREST70972
Physical form: Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.
RIDADR NONH for all modes of transport
WGK Germany WGK 1
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top