Advanced Search



Anti-TOX3 antibody produced in rabbit

SIGMA/HPA040376 - Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym: Anti-Cagf9; Anti-Tnrc9; Anti-Tox high mobility group box family member 3

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-HPA040376-100UL 100 µL
$607.00
1/EA
Add To Favorites
Enhanced Validation-Orthogonal RNAseq Confirmation Immunohistochemistry analysis in human gallbladder and lymph node tissues using HPA040376 antibody. Corresponding TOX3 RNA-seq data are presented for the same tissues.
ChIP-Exo-Seq composite graph for Anti-TOX3 (HPA040376, Lot 000041382) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University. *Please note not all antibody batches are validated for use in ChIP applications.
Immunohistochemistry Immunohistochemical staining of human Gallbladder shows strong nuclear positivity in glandular cells.
Immunohistochemistry Immunohistochemical staining of human Cerebral cortex shows moderate nuclear positivity in neuronal cells.
Immunohistochemistry Immunohistochemical staining of human Stomach shows moderate nuclear positivity in glandular cells.
Immunohistochemistry Immunohistochemical staining of human Lymph node shows no positivity in non-germinal center cells as expected.
Immunohistochemistry Immunohistochemical staining of human Skeletal muscle shows no positivity in myocytes as expected.

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
conjugate unconjugated
enhanced validation orthogonal RNAseq
Learn more about Antibody Enhanced Validation 
form buffered aqueous glycerol solution
immunogen sequence SQGSEFTPQFPPQSLDLPSITISRNLVEQDGVLHSSGLHMDQSHTQVSQYRQDPSLIMRSIVHMTDAARSGVMP
product line Prestige Antibodies® Powered by Atlas Antibodies
Quality Level 100 
shipped in wet ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) ChIP: 1—10 μg (per reaction)
  immunohistochemistry: 1:200- 1:500
UniProt accession no. O15405 
Application: Anti-TOX3 antibody produced in rabbit has been used in immunohistochemistry.
Biochem/physiol Actions: TOX high mobility group box family member 3 (TOX3) interacts with cAMP response element (CRE)-binding protein (CREB) and CREB-binding protein (CBP) and regulates calcium-dependent transcription in neurons. Overexpression or mutation of the gene is associated with the development and progression of breast cancer.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Features and Benefits: Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.
General description: The TOX high mobility group box family member 3 (TOX3) gene with seven exons, is mapped to human chromosome 16q12. The encoded protein is mainly expressed in brain and breast. TOX3 includes a high mobility group box (HMG-box) domain and a C- terminal polyglutamine stretch.
Immunogen: TOX high mobility group box family member 3 recombinant protein epitope signature tag (PrEST)
Legal Information: Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Other Notes: Corresponding Antigen APREST81832
Physical form: Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.
RIDADR NONH for all modes of transport
WGK Germany WGK 1
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top