Advanced Search



Interferon-γ human

SIGMA/I17001 - IFN-gamma, recombinant, expressed in HEK 293 cells, suitable for cell culture, endotoxin tested

Synonym: IFN-γ

MDL Number: MFCD00131391
Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-I17001-100UG 100 µg
$455.00
1/EA
Add To Favorites
Purity
The purity of human, recombinant IFN-γ expressed in HEK 293 cells (Cat. No. I17001) was assessed on SDS-PAGE (1.25 μg/lane) under reducing conditions (+DTT) followed by InstantBlue™ staining (Cat. No. ISB1L).
Deglycosylation Test
Human, recombinant IFN-γ expressed in HEK 293 cells (Cat. No. I17001) (lanes 1-2) and IFN-γ expressed in E. coli (lanes 3-4) were either treated with N glycosidase F (lanes 1,3) or untreated (lanes 2,4) and separated on SDS-PAGE followed by InstantBlue™ staining (Cat. No. ISB1L).
Lanes
1. HEK 293 I17001 (+ N glycosidase F)
2. HEK 293 I17001 (- N glycosidase F)
3. E. coli (+ N glycosidase F)
4. E. coli (- N glycosidase F)
Bioassay The biological activity of human, recombinant IFN-γ expressed in HEK293 cells (Cat. No. I17001) versus control IFN-γ from E. coli was measured in a viral resistance assay. The ED50 is defined as the effective concentration of IFN-γ that allows 50% cell growth in an antiviral cell based bioassay. The ED50 of recombinant IFN-γ expressed in HEK293 cells (Cat. No. I17001) is 15 fold more active than the E. coli expressed version. (Representative result)

 

assay ≥98% (SDS-PAGE)
form lyophilized powder
mol wt 16 kDa (glycosylated)
potency ≤0.250 ng/mL In Viral Resistance Assay ED50
Quality Level 200 
recombinant expressed in HEK 293 cells
storage temp. −20°C
suitability endotoxin tested
technique(s) cell culture | mammalian: suitable
Analysis Note: The biological activity of recombinant human IFN-γ was tested in culture in a viral resistance assay. The ED50 is defined as the effective concentration of IFN-γ that allows 50% cell growth in an antiviral cell based bioassay.
Application: Interferon-γ human has been used in cytometric bead array to measure the levels of interferon-γ in the sample.
Application: It has also been used for cytokine treatment of human islets to evaluate the activation of hypoxia inducible factor 1 α (HIF1α) targets, in vitro.
Biochem/physiol Actions: IFN-γ is a dimerized soluble cytokine that is the only member of the type II class of interferons.
Interferon-γ (IFN-γ) plays an essential role in function of virtually all immune cells and both innate and adaptive immune responses. IFN-γ exhibits various biological effects, such as antiviral activity, inhibition of cell or tumor growth and promotion of terminal differentiation of B cells into immunoglobulin-producing cells. This cytokine also activates macrophages, increases cytotoxicity of natural killer cells and promotes T cell cytotoxicity. In addition to antiviral activity, recombinant human IFN-γ is a potent modulator of immune responses and modifies cellular processes.
General description: Interferon-γ (IFN-γ) is a pleotropic cytokine, encoded by the gene mapped to human chromosome 12q15. It is a non-covalent homodimer with two identical 17kDa polypeptide chains. It belongs to the type II class of interferons.
General description: Recombinant human Interferon-γ (IFN-γ) is expressed in human 293 cells as a glycoprotein with a calculated molecular mass of 16 kDa. This protein is manufactured in human cells using an all-human production system, with full chemically defined ingredients and with no serum. The human cells expression system allows human-like glycosylation and folding, and often supports better stability of the protein in culture. The bioactivity of IFN-γ expressed in human 293 cells is significantly higher compared to bacterially expressed IFN-γ.
Other Notes: QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRG
Physical form: Supplied as a lyophilized powder containing phosphate buffered saline.
Hazard statements H412
Precautionary statements P273 - P501
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Purity ≥98% (SDS-PAGE)
Storage Temp. −20°C
UNSPSC 12352202

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top