Advanced Search



Membrane Scaffold Protein 1E3D1

SIGMA/M7074 - recombinant, expressed in E. coli

Synonym: MSP1E3D1

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-M7074-5MG 5 mg
$599.00
1/EA
Add To Favorites
The concept of membrane scaffold proteins was originally derived from the naturally occurring apoliporotein A-I component of high density lipoprotein. Phospholipid bilayer nanodiscs have been utilized to incorporate a wide variety of anchored and transmembrane proteins. Nanodiscs can provide improved solubility, homogeneity and more native conditions over traditional microsomal preparation.
The critical component of Nanodiscs is the encircling amphipathic helical protein belt (membrane scaffold protein or MSP). The MSP1D1 construct generates Nanodiscs ~9.8 nm in diameter typically containing ~150 lipid molecules per Nanodisc. The thickness of a Nanodisc can vary depending on the type of phospholipid incorporated (typically 4.6–5.6 nm).
Our two constructs, MSP1D1 and MSP1E3D1, allow the incorporation of a broad range of target protein sizes, generating Nanodiscs of ~10.6 and ~12.9 nm in diameter, respectively.

 

ε (extinction coefficient) 26,600 M-1cm-1 at 280 nm (His-tag-cleaved dissolved in 20 mM Tris pH 7.4, 0.1M NaCl, 0.5mM EDTA and 0.01%NaN3)(lit.)
  29,400 M-1cm-1 at 280 nm (uncleaved His-tagged dissolved in 20 mM Tris pH 7.4, 0.1M NaCl, 0.5mM EDTA and 0.01%NaN3)(lit.)
biological source Streptomyces kanamyceticus
description N-Terminal histidine-tagged
form lyophilized powder
mol wt Mw 32599.98 by amino acid sequence
Quality Level 200 
recombinant expressed in E. coli
storage temp. −20°C
Application: For an extensive list of citations and protocols visit the Sligar Lab Website at; sligarlab.life.uiuc.edu/nanodisc.html
Application: For guidelines on the use of this and other MSP′s to prepare Nanodiscs, please visit our Protocols for Membrane Scaffold Proteins and Nanodisc Formation page .
Application: Nanodisc soluble lipid bilayer systems have proven to be a widely applicable means for rendering membrane proteins soluble in aqueous solutions in a native-like bilayer environment where they remain monodisperse and active. The critical component of nanodiscs is the encircling amphipathic helical protein belt (membrane scaffold protein).
Application: The nanodisc system has been employed to incorporate a wide variety of proteins including GPCRs, P450s, bacteriorhodopsin, coagulation factors, cholera toxin, TAR receptor and aromatase.
Biochem/physiol Actions: Generates Nanodiscs ~12.9 nm in diameter
General description: Sequence: GHHHHHHHDYDIPTTENLYFQGSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ
General description: The nanodisc concept is derived from high density lipoprotein (HDL) particles and their primary protein component, apolipoprotein. The nanodisc is a non-covalent structure of phospholipid bilayer and membrane scaffold protein (MSP), a genetically engineered protein, which mimics the function of Apolipoprotein A-1 (ApoA-1). A soluble nanodisc assembles as the phospholipid forms a bilayer, which is encircled by two amphipathic MSP molecules covering the hydrophobic alkyl chains of the bilayer. The length of the MSP controls the size of the nanodisc structure. MSP1E3D1 yields nanodiscs of ~12.9 nm. The thickness of a nanodisc is dependent on the type of phospholipid incorporated (typically 4.6−5.6 nm).
Legal Information: Nanodisc technology, and many of its uses, are covered by the following patents held by the University of Illinois.
• 7,691,414 Membrane scaffold proteins
• 7,662,410 Membrane scaffold proteins and embedded membrane proteins
• 7,622,437 Tissue factor compositions and methods
• 7,592,008 Membrane scaffold proteins
• 7,575,763 Membrane scaffold proteins and tethered membrane proteins
• 7,083,958 Membrane scaffold proteins
• 7,048,949 Membrane scaffold proteins
Physical form: Supplied as a lyophilized histidine-tagged protein with a TEV protease cleavage site stabilized with Tris-HCl, EDTA, and NaCl.
Symbol GHS07  GHS07
Signal word Warning
Hazard statements H315 - H319 - H335
Precautionary statements P261 - P305 + P351 + P338
Hazard Codes Xi
Risk Statements 36/37/38
Safety Statements 26
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352202

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top