Advanced Search



SILuMAb Adalimumab Stable-Isotope Labeled Monoclonal Antibody

SIGMA/MSQC11

Synonym: Mass spectrometry standard, Adalimumab; SIL Adalimumab; Stable isotope labelled Adalimumab

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-MSQC11-100UG 100 µg
$419.00
1/EA
Add To Favorites
SILu™MAb Adalimumab Stable-Isotope Labeled Universal Monoclonal Antibody, Cat. No. MSQC11: Extracted ion chromatogram (XIC) of a representative peptide from the digested SILuMAb Adalimumab. This internal standard enables sensitive, accurate, and reproducible quantification Adalimumab.

 

antibody product type primary antibodies
assay ≥90% (SDS-PAGE)
packaging vial of 100 μg
Quality Level 200 
recombinant expressed in CHO cells
shipped in wet ice
storage temp. −20°C
Analysis Note: Quantitative
MRM settings provided (xls )
Application: Poster: Multiplex Quantification of Infliximab and Adalimumab in Human Serum by LC-MS/MS Using Full-Length Stable Isotope Labeled Internal Standards 
General description: SILu MAb Adalimumab Stable-Isotope Labeled Monoclonal Antibody is a recombinant, stable isotope labeled, monoclonal antibody which incorporates [13C6, 15N4]-Arginine and [13C6, 15N2]-Lysine. Expressed in CHO cells, SILuMAb Adalimumab is designed to be used as an internal standard for analysis of Adalimumab in human serum. Each vial of SILuMAb Adalimumab contains the labeled antibody lyophilized from a solution of phosphate buffered saline. Vial content was determined by measuring A280 and using an extinction coefficient (E0.1%) of 1.4.
SILu MAb Adalimumab is for R&D use only. Not for drug, household, or other uses.
Immunogen: SILuMab Adalimumab Heavy Chain: EVQLVESGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSAITWNSGHIDYADSVEGR
FTISRDNAKNSLYLQMNSLRAEDTAVYYCAKVSYLSTASSLDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNS
GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEV
TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRD
ELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG

SILuMab Adalimumab Light Chain:
DIQMTQSPSSLSASVGDRVTITCRASQGIRNYLAWYQQKPGKAPKLLIYAASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCQRYNRAPYTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Legal Information: SILu is a trademark of Sigma-Aldrich Co. LLC
Legal Information: This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.
Other Notes: Adalimumab-Specific Peptide Sequences Liberated from SILuMAb Adalimumab by Tryptic Digest

Universal Peptide Sequence Location
GLEWVSAITWNSGHIDYADSVEGR Heavy chain
APYTFGQGTK Light chain
FSGSGSGTDFTLTISSLQPEDVATYYCQR Light chain
Preparation Note: Each vial of SILuMab Adalimumab contains the labeled antibody in a lyophilized form containing phosphate buffered saline.
Preparation Note: Produced utilizing enriched media containing stable isotope labeled amino acids are 13C6, 15N4-labeled Arginine and 13C6, 15N2-labeled Lysine.
SILuMab Adalimumab is designed to be used as a internal standard for analysis of Adalimumab in human serum.
Preparation Note: SILuMab Adalimumab recovery is maximized when 0.1% formic acid is used for reconstitution of the lyophilized product.Reconstitution with other solvents may reduce recovery. Do not freeze after reconstitution.

•  Briefly centrifuge the vial at ~10,000 × g to collect the product at the bottom of the vial.
• Add 500 μL of ultrapure water containing 0.1% formic acid to the vial.
• Mix the contents by gently inverting the vial a minimum of 5 times.
• Allow the vial to stand at room temperature for at least 15 minutes and repeat mixing by inversion.
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Purity ≥90% (SDS-PAGE)
Storage Temp. −20°C
UNSPSC 41105501

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top