Advanced Search



SILuMAB K1 Stable-Isotope Labeled Universal Monoclonal Antibody

SIGMA/MSQC6 - recombinant, expressed in CHO cells

Synonym: SILuMAB Stable-Isotope Labeled Universal Monoclonal Antibody Standard human; IgG1 kappa; K1 Stable-Isotope Labeled Universal Monoclonal Antibody

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-MSQC6-100UG 100 µg
$431.00
1/EA
Add To Favorites
45-MSQC6-5MG 5 mg
$19240.00
1/EA
Add To Favorites
SILu™MAb K1 Stable-Isotope Labeled Universal Monoclonal Antibody, Cat. No. MSQC6 : Extracted ion chromatogram (XIC) of representative peptides from the digested SILuMAb K1. Data was obtained from a 250 fmol injection of a SILu™MAb K1 tryptic digest. Using optimized overlap with common sequences in the Fc region of candidate antibodies, SILu™MAb K1 provides universal utility, thus eliminating the need for production of candidate-specific internal standards.

 

antibody product type primary antibodies
assay ≥90% (SDS-PAGE)
packaging vial of 100 μg (± 10% Lot-specific vial content given on certificate of analysis)
Quality Level 200 
recombinant expressed in CHO cells
shipped in wet ice
storage temp. −20°C
Analysis Note: Quantitative
MRM settings provided (xls )
Analysis Note: SILuMAb K1 Heavy Chain

EVQLVESGGGLVQPGGSLRLSCVASGFTLNNYDMHWVRQGIGKGLEWVSKIGTAGDRYYAGSVKGRFTISRENAKDSLYLQMNSLRVGDAAVYYCARGAGRWAPLGAFDIWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG

SILuMAb K1 Light Chain

QSALTQPRSVSGSPGQSVTISCTGTSSDIGGYNFVSWYQQHPGKAPKLMIYDATKRPSGVPDRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGDYTPGVVFGGGTKLTVLTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Target overlap areas are underlined
Package size based on protein content determined by A280 using an extinction coefficient (E0.1%) of 1.4
Application: SILu MAB K1 Stable-Isotope Labeled Universal Monoclonal Antibody has been used to spike peptide samples to assess preparation reproducibility.
Features and Benefits: Universal Peptide Sequence Location
FNWYVDGVEVHNAK Heavy Chain (IgG1)
VVSVLTVLHQDWLNGK Heavy Chain (IgG1, IgG3, IgG4)
GFYPSDIAVEWESNGQPENNYK Heavy Chain (IgG1, IgG4)
SGTASVVCLLNNFYPR Light Chain (kappa)
VDNALQSGNSQESVTEQDSK Light Chain (kappa)
DSTYSLSSTLTLSK Light Chain (kappa)

SILuMab has been validated as an internal standard for quantitation of relevant biotherapeutics in a complex biological matrix by MRM-based LC-MS/MS.
• SILuMab yielded reproducible, linear curves from 0.1 μg/mL to 1000 μg/mL without enrichment or depletion.
• Good agreement was observed between multiple peptides derived from the same target.
• Label incorporation was determined to be >98% by mass spectrometry.
• Sequence coverage was confirmed by peptide mapping.
Legal Information: SILu is a trademark of Sigma-Aldrich Co. LLC
Legal Information: This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.
Physical form: Supplied as a lyophilized powder containing phosphate buffered saline
Preparation Note: Produced utilizing enriched media containing stable isotope labeled amino acids are 13C<SUB>6</SUB>, 15N<SUB>4</SUB>-labeled Arginine and 13C<SUB>6</SUB>, 15N<SUB>2</SUB>-labeled Lysine.
Preparation Note: SILuMab design is optimized to be used as an internal standard for quantitation of monoclonal antibodies as well as Fc-fusion therapeutics. Because of overlap with the common sequences in the Fc region with candidate antibodies, SILuMab provides univer­sal utility, thus eliminating the need for production of candidate-specific internal standards.
Preparation Note: SILuMab recovery is maximized when 0.1% formic acid is used for reconstitution of the lyophilized product. Reconstitution with other solvents may reduce recovery. Do not freeze after reconstitution.
Procedure
• Briefly centrifuge the vial at ~10,000 x g to collect the product at the bottom of the vial.
• Add 500 μL of purified water containing 0.1% formic acid to the vial.
• Mix the contents by gently inverting the vial a minimum of 5 times.
• Allow the vial to stand at room temperature for a minimum of 15 minutes and repeat mixing by inversion.
RIDADR NONH for all modes of transport
WGK Germany WGK 1
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Purity ≥90% (SDS-PAGE)
Storage Temp. −20°C
UNSPSC 12352200

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top