SILu™Lite APOA1 Apolipoprotein A-1 human
SIGMA/MSST0002 - recombinant, expressed in HEK 293 cells, MS Protein Standard
Synonym: SILuLite Apolipoprotein A-1
Product Type: Chemical
| assay | ≥98% (SDS-PAGE) |
| biological source | human |
| form | lyophilized powder |
| packaging | vial of 50-65 μg (Lot-specific vial content given on certificate of analysis) |
| Quality Level | 200 ![]() |
| recombinant | expressed in HEK 293 cells |
| storage temp. | −20°C |
| tag | His tagged |
| V5 tagged | |
| technique(s) | mass spectrometry (MS): suitable |
| UniProt accession no. | P02647 ![]() |
| Analysis Note: | General Description SILuLite APOA1 is a recombinant human protein expressed in human 293 cells. It is a monomer of 286 amino acids (including N-terminal signal sequence and C-terminal polyhistidine and V5 tags), with a molecular weight of 32.1 kDa. SILuLite APOA1 is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications. Sequence RHFWQQDEPPQSPWDRVKDLATVYVDVLKDS The N-terminal signal peptide and C-terminal linker peptide, V5 and polyhistidine tags are italicized. Other Characterization • Sequence confirmed by intact mass analysis • Identity verified by peptide mapping • purity >98% (SDS-PAGE) • Vial content was determined by the Bradford method using BSA as a calibrator. The correction factor of Bradford-to-AAA is 88.33% Suggested Quantitative Analysis Parameters (MRM settings provided for three suggested peptides ) |
| Biochem/physiol Actions: | Apolipoprotein A-1(Apo-A1), is a major protein component of high density lipoprotein (HDL)in plasma1. The protein promotes cholesterol efflux from tissues to the liver for excretion, and it is a cofactor for lecithin cholesterolacyltransferas |
| Legal Information: | SILu is a trademark of Sigma-Aldrich Co. LLC |
| Physical form: | Supplied as a lyophilized powder containing phosphate buffered saline. |
| RIDADR | NONH for all modes of transport |
| WGK Germany | WGK 3 |
| Flash Point(F) | Not applicable |
| Flash Point(C) | Not applicable |
| Purity | ≥98% (SDS-PAGE) |
| Storage Temp. | −20°C |
| UNSPSC | 23201100 |

