Advanced Search



SILuProt IL6 Interleukin 6 human

SIGMA/MSST0017 - recombinant, expressed in HEK 293 cells, SIL MS Protein Standard, 13C- and 15N-labeled

Synonym: B-cell stimulatory factor 2 (BSF-2); CTL differentiation factor (CDF); Hybridoma growth factor; IL-6; Interferon beta-2 (IFN-beta-2)

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-MSST0017-10UG 10 µg
$836.00
1/EA
Add To Favorites
SILuProt products are stable isotope-labeled full length proteins designed to be used as mass spectrometry internal standards for quantitative proteomics. Introduction of an internal SILuProt standard at the beginning of the MS workflow minimizes variations in quantification due to protein extraction, fractionation, enrichment, proteolysis and analysis
Incorporation of stable isotope­labeled amino acids 13C615N4Arg and 13C615N2Lys for representative peptides from SILuProt IL6 was >98%. (Chart 1)
Incorporation of stable isotope­labeled amino acids 13C615N4Arg and 13C615N2Lys for representative peptides from SILuProt IL6 was >98%. (Chart 2)
Incorporation of stable isotope­labeled amino acids 13C615N4Arg and 13C615N2Lys for representative peptides from SILuProt IL6 was >98%. (Chart 3)

 

assay 98% (SDS-PAGE)
biological source human
form lyophilized powder
potency ≥98% Heavy amino acids incorporation efficiency by MS
Quality Level 200 
recombinant expressed in HEK 293 cells
storage temp. −20°C
suitability suitable for mass spectrometry (standard)
technique(s) mass spectrometry (MS): suitable
UniProt accession no. P05231 
Biochem/physiol Actions: IL-6 is an abundant cytokine, which is crucial for leukocyte and endothelial cell activation. IL-6 is one of the major cytokines that are implicated clinically as biomarkers in ACS (Acute Coronary Syndrome). Its pathophysiological contribution to ACS is the induction of acute-phase response. Patients with ACS have increased circulating levels of IL-6 compared with those patients who have stable angina. Among patients with unstable angina, an increase in IL-6 levels that occurred 48 hours after admission compared with the admission value was associated with the combined end point of death, myocardial infarction (MI), or refractory angina. High levels of IL-6 are also related to cardiovascular disease, heart attack, and stroke.
General description: SILu Prot IL-6 is a recombinant, stable isotope-labeled human IL-6 which incorporates [13C6, 15N4]-Arginine and [13C6, 15N2]-Lysine. Expressed in human 293 cells, it is designed to be used as an internal standard for bioanalysis of IL-6 in mass-spectrometry. SILu Prot IL-6 is a monomer of 183 amino acids, with a molecular weight of ~21 kDa.

Suggested Quantitative Analysis Parameters
(MRM settings provided for three suggested peptides )
Legal Information: SILu is a trademark of Sigma-Aldrich Co. LLC
Legal Information: This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.
Other Notes: VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Physical form: Supplied as a lyophilized powder containing phosphate buffered saline.
RIDADR NONH for all modes of transport
WGK Germany WGK 2
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Purity 98% (SDS-PAGE)
Storage Temp. −20°C
UNSPSC 23201100

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top