Advanced Search



Noggin human

SIGMA/N17001 - recombinant, expressed in HEK 293 cells, suitable for cell culture

Synonym: Noggin human

MDL Number: MFCD05665420
Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-N17001-20UG 20 µg
$421.00
1/EA
Add To Favorites
Purity The purity of human, recombinant Noggin expressed in HEK 293 cells (Cat. No. N17001) was assessed on SDS-PAGE under reducing conditions (+ DTT) followed by InstantBlue™ staining (Cat. No. ISB1L). Lanes 1. 1.25 μg/lane 2. 2.5 μg/lane 3. 5 μg/lane
This picture is provided solely for illustration purposes. Optical properties of the actual product may deviate. Relevant product information is printed on labeled products and other accompanying or available information material. This image depicts SKU: N17001-20UG.
Bioassay The biological activity of recombinant Noggin expressed in HEK 293 cells (Cat. No. N17001) was measured in ATDC-5 cells by inhibition of BMP-4 induced alkaline phosphatase production. The EC50 is defined as the effective concentration that elicits a 50% inhibition of BMP-4 induced alkaline phosphatase production in a cell-based bioassay.

 

assay ≥98% (SDS-PAGE)
form lyophilized powder
mol wt 23 kDa (The protein migrates as a 25 kDa band on SDS-PAGE due to glycosylation)
potency ≤10 ng/mL ED50
Quality Level 200 
recombinant expressed in HEK 293 cells
storage temp. −20°C
technique(s) cell culture | mammalian: suitable
Analysis Note: The biological activity of recombinant human noggin was tested in culture by measuring its ability to inhibit BMP4-induced alkaline phosphatase production by ATDC5 cells (human erythroleukemic indicator cell line).
The EC50 is defined as the effective concentration of growth factor that elicits a 50% decrease in alkaline phosphatase secretion in a cell based bioassay.
Biochem/physiol Actions: Noggin is a secreted protein that inhibits the binding of bone morphogenetic proteins (BMPs) to their cognate receptor. It is a 232 amino acid-secreted glycosylated protein, which forms covalently linked homodimers and has high affinity for BMP4. hESC cultured with noggin (in medium or incorporated into extracellular matrix) form denser colonies compared to normal hESC cultures, suggesting that the presence of noggin promotes better growth. Noggin can be incorporated as a medium supplement for maintaining stem cells in a pluripotent state, for short-term culture experiments. Noggin does not trigger differentiation towards a neuronal lineage. Furthermore, when incorporated into extracellular matrix, noggin prevented spontaneous differentiation during the time period examined. In a surgically induced knee osteoarthritis model in mice, expression of noggin mRNA was lost from the articular cartilage, which correlated with loss of BMP2/4 and pSMAD1/5/8, an indicator of active BMP signaling.
General description: Recombinant human Noggin is expressed in human 293 cells as a glycoprotein with a calculated molecular mass of 23 kDa. This protein is manufactured in human cells using an all-human production system, with no serum. The human cells expression system allows human-like glycosylation and folding, and often supports better stability of the protein in culture.
Other Notes: QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC
Physical form: Supplied as a lyophilized powder containing phosphate buffered saline.
Hazard statements H412
Precautionary statements P273 - P501
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Purity ≥98% (SDS-PAGE)
Storage Temp. −20°C
UNSPSC 12352202

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top