Advanced Search



Superoxide Dismutase bovine

SIGMA/S9697 - recombinant, expressed in E. coli, lyophilized powder, ≥2500 units/mg protein, ≥90% (SDS-PAGE)

Synonym: Superoxide Dismutase 1 bovine; cytocuprein; erythrocuprein; hemocuprein; CU/ZN-SOD; SOD; SOD1; Superoxide: superoxide oxidoreductase

CAS Number: 9054-89-1
EC Number: 232-943-0
MDL Number: MFCD00132404
Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-S9697-15KU 15000 units
$105.00
1/EA
Add To Favorites
45-S9697-30KU 30000 units
$153.00
1/EA
Add To Favorites
45-S9697-75KU 75000 units
$307.00
1/EA
Add To Favorites
45-S9697-300KU 300000 units
$1150.00
1/EA
Add To Favorites
SOD catalyzes the conversion of superoxide radicals into hydrogen peroxide and molecular oxygen.
SOD from bovine erythrocytes is a homodimeric non-covalently bound protein with two 16.3 kDa subunits of 151 amino acids. Each monomer has one intrachain disulfide and one free sulfhydryl, two copper atoms and two zinc atoms.
Multiple enzymatic scavengers are utilized by the cell to limit damage from reactive oxygen species. These scavengers include members of the superoxide dismutase (SOD) family, catalase, and glutathione peroxidase.
SDS-PAGE Superoxide Dismutase bovine (Cat. No. S9697) was assessed on SDS-PAGE.

 

assay ≥90% (SDS-PAGE)
biological source bovine
color white
form lyophilized powder
NCBI accession no. NM_174615 
  NP_777040 
optimum pH 7.8 (25 °C)
pH range 7.6-10.5
pI  4.95
Quality Level 200 
recombinant expressed in E. coli
sequence note MATKAVCVLKGDGPVQGTIHFEAKGDTVVVTGSITGLTEGDHGFHVHQFGDNTQGCTSAGPHFNPLSKKHGGPKDEERHVGDLGNVTADKNGVAIVDIVDPLISLSGEYSIIGRTMVVHEKPDDLGRGGNEESTKTGNAGSRLACGVIGIAK
specific activity ≥2500 units/mg protein
storage condition (Tightly closed)
storage temp. −20°C
technique(s) inhibition assay: suitable
UniProt accession no. A4URH1 
Analysis Note: Extinction coefficient: EmM= 10.3 (258 nM)
SOD has no significant absorbance peak at 280 nM because of the absence of tryptophan.
Application: Superoxide Dismutase bovine has been used:

•  to construct a calibration curve for the evaluation of superoxide dismutase (SOD) enzyme activities
•  in a study to investigate where lipoproteins may affect the L-arginine-nitric oxide pathway
•  in a study to investigate the mass spectral evidence for carbonate-anion-radical-induced posttranslational modification of tryptophan to kynurenine in human Cu, Zn superoxide dismutase
Biochem/physiol Actions: Superoxide dismutase (SOD) catalyzes the dismutation of superoxide radicals to hydrogen peroxide and molecular oxygen. This reaction in turn activates redox-sensitive kinases and inactivates specific phosphatases to regulate redox-sensitive signaling pathway, including hypertrophy, proliferation, and migration. SOD serves as a potent antioxidant and protects the cells against the toxic effects of oxygen radicals. SOD may also suppress apoptosis by competing with nitric oxide (NO) for superoxide anion, which reacts with NO to form peroxynitrite, an inducer of apoptosis.
General description: Research area: Cell Signaling

SOD from bovine erythrocytes was the first SOD to be found in mammalian tissues. There are three forms of SOD differentiated by the metal ions in the active site. These are Cu+2/Zn+2, Mn+2, and Fe+2 SOD. In vertebrates, Cu/Zn-SOD is found in the cytoplasm, chloroplast, and may be in extracellular space, while Mn-SOD is found in the mitochondrial matrix space and peroxisome. Fe-SOD is found in the chloroplast of prokaryotes and some higher plants.
Other Notes: Inhibitors: cyanide, OH- (competitive), hydrogen peroxide
Other Notes: One unit will inhibit reduction of cytochrome c by 50% in a coupled system with xanthine oxidase at pH 7.8 at 25°C in a 3.0 ml reaction volume. Xanthine oxidase concentration should produce an initial ΔA550 of 0.025 ± 0.005 per min.
Packaging: 15000 units in glass bottle
Packaging: 30000, 75000, 300000 units in poly bottle
Preparation Note: Produced using animal component-free materials.
Preparation Note: Reconstitute in 10 mM potassium phosphate, pH 7.4.
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Purity ≥90% (SDS-PAGE)
activity specific activity: ≥2500 units/mg protein
Storage Temp. −20°C
Enzyme Commission (EC) Number 1.15.1.1   ( BRENDA  | IUBMB  )
UNSPSC 12352204

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top