Advanced Search



Anti-HLA-DRB3 antibody produced in mouse

SIGMA/SAB1400125 - IgG fraction of antiserum, buffered aqueous solution

Synonym: Anti-HLA-DR3B; Anti-MGC117330

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-SAB1400125-50UG 50 µg
$580.00
1/EA
Add To Favorites
Western Blotting HLA-DRB3 polyclonal antibody. Western Blot analysis of HLA-DRB3 expression in human liver.
Western Blotting Western Blot analysis of HLA-DRB3 expression in transfected 293T cell line by HLA-DRB3 polyclonal antibody. Lanes Lane 1: HLA-DRB3 transfected lysate (29.26 kDa). Lane 2: Non-transfected lysate.
Flow Cytometry FACS analysis of negative control 293 cells (Black) and HLA-DRB3 expressing 293 cells (Green) using HLA-DRB3 purified mouse polyclonal antibody.

 

antibody form IgG fraction of antiserum
antibody product type primary antibodies
biological source mouse
clone polyclonal
conjugate unconjugated
form buffered aqueous solution
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) flow cytometry: suitable
  western blot: 1 μg/mL
UniProt accession no. P79483 
General description: HLA-DRB3 belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DRA) and a beta (DRB) chain, both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa and its gene contains 6 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. Within the DR molecule the beta chain contains all the polymorphisms specifying the peptide binding specificities. Typing for these polymorphisms is routinely done for bone marrow and kidney transplantation. DRB1 is expressed at a level five times higher than its paralogues DRB3, DRB4 and DRB5. The presence of DRB3 is linked with allelic variants of DRB1, otherwise it is omitted. There are 4 related pseudogenes: DRB2, DRB6, DRB7, DRB8 and DRB9. (provided by RefSeq)
Immunogen: HLA-DRB3 (NP_072049.2, 1 a.a. ~ 266 a.a) full-length human protein.

Sequence
MVCLKLPGGSSLAALTVTLMVLSSRLAFAGDTRPRFLELRKSECHFFNGTERVRYLDRYFHNQEEFLRFDSDVGEYRAVTELGRPVAESWNSQKDLLEQKRGRVDNYCRHNYGVGESFTVQRRVHPQVTVYPAKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSALTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top