Advanced Search



Monoclonal Anti-SMAD3 antibody produced in mouse

SIGMA/SAB1400160 - clone 7F3, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-DKFZP586N0721; Anti-DKFZp686J10186; Anti-HSPC193; Anti-HsT17436; Anti-JV152; Anti-MADH3; Anti-MGC60396; Anti-Smad 3

MDL Number: MFCD02097405
Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-SAB1400160-100UG 100 µg
$580.00
1/EA
Add To Favorites
Immunohistochemistry Immunoperoxidase of monoclonal antibody to SMAD3 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 μg/mL]
Proximity Ligation Assay Proximity Ligation Analysis of protein-protein interactions between MAPK8 and SMAD3. HeLa cells were stained with anti-MAPK8 rabbit purified polyclonal 1:1200 and anti-SMAD3 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Western Blotting SMAD3 monoclonal antibody, clone 7F3. Western Blot analysis of SMAD3 expression in HeLa.
Western Blotting SMAD3 monoclonal antibody, clone 7F3. Western Blot analysis of SMAD3 expression in PC-12.
Western Blotting Western Blot analysis of SMAD3 expression in transfected 293T cell line by SMAD3 monoclonal antibody, clone 7F3. Lanes Lane 1: SMAD3 transfected lysate (48 kDa). Lane 2: Non-transfected lysate.
Western Blotting SMAD3 monoclonal antibody, clone 7F3. Western Blot analysis of SMAD3 expression in 293.
Western Blotting SMAD3 monoclonal antibody, clone 7F3. Western Blot analysis of SMAD3 expression in Jurkat.
Western Blotting SMAD3 monoclonal antibody, clone 7F3. Western Blot analysis of SMAD3 expression in human colon.
Western Blotting QC Western Blot detection against Immunogen (36.96 kDa).
ELISA Detection limit for recombinant GST tagged SMAD3 is approximately 0.1 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
application(s) research pathology
biological source mouse
clone 7F3, monoclonal
conjugate unconjugated
form buffered aqueous solution
isotype IgG1κ
Quality Level 100 
shipped in dry ice
species reactivity human, rat
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
  indirect ELISA: suitable
  proximity ligation assay: suitable
  western blot: 1-5 μg/mL
UniProt accession no. P84022 
Application: Monoclonal Anti-SMAD3 antibody produced in mouse has been used in immunohistochemistry (1:200).
Biochem/physiol Actions: Mothers against decapentaplegic homolog 3 (SMAD3) protein possesses tumor-suppressive actions. It is involved in epithelial to mesenchymal transition (EMT). SMAD3 also possesses tumor-promoting actions of transforming growth factor-beta (TGF-β). The N-terminal domain Mad homology 1 (MH1) of SMAD3 plays a role in DNA binding. The SMAD3 gene mutation is linked to an increased incidence of knee osteoarthritis. DNA methylation change in the SMAD3 gene promoter is associated with atopic asthma. SMAD3 protein plays a regulatory role in immune responses. It also modulates fibrosis in the airways.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: Mothers against decapentaplegic homolog 3 (SMAD3) protein is an important constituent of the transforming growth factor-beta (TGF-β) signaling pathway. Mad homology 1 (MH1) and Mad homology 2 (MH2) are the two functional domains of the SMAD3. The SMAD3 gene is located on human chromosome 15q22.33.
Immunogen: SMAD3 (NP_005893, 120 a.a. ~ 221 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
VCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDL
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top