Advanced Search



Monoclonal Anti-CITED4 antibody produced in mouse

SIGMA/SAB1400832 - clone 4F6, purified immunoglobulin, buffered aqueous solution

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-SAB1400832-100UG 100 µg
$580.00
1/EA
Add To Favorites
Immunohistochemistry Immunoperoxidase of monoclonal antibody to CITED4 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 μg/mL]
Immunofluorescence Immunofluorescence of monoclonal antibody to CITED4 on HeLa cell. [antibody concentration 10 μg/mL]
Western Blotting Western Blot analysis of CITED4 expression in transfected 293T cell line by CITED4 monoclonal antibody, clone 4F6. Lanes Lane 1: CITED4 transfected lysate (18.6 kDa). Lane 2: Non-transfected lysate.
Western Blotting QC Western Blot detection against Immunogen (31.68 kDa).

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 4F6, monoclonal
conjugate unconjugated
form buffered aqueous solution
isotype IgG2aκ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunofluorescence: suitable
  indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. Q96RK1 
Biochem/physiol Actions: CITED4 (Cbp (CREB-binding protein)/p300-interacting transactivator 4) is a transcriptional cofactor. It is found to be downregulated in some of the tumor types including colorectal cancer. It is involved in the regulation of TGFB (transforming growth factor β1), TFAP2 (transcription factor A) and HIF1A (hypoxia inducible factor 1 αsubunit). It prevents the transactivation of HIF1A by inhibiting its binding to p300. CITED4 is known to be involved in the development of neural crest and neural tube.
Features and Benefits: Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more. 
General description: CITED4 (Cbp (CREB-binding protein)/p300-interacting transactivator 4) gene is mapped to human chromosome 1p34.2.
Immunogen: CITED4 (NP_597724.1, 131 a.a. ~ 184 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
GMDAELIDEEALTSLELELGLHRVRELPELFLGQSEFDCFSDLGSAPPAGSVSC
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top