Advanced Search



Monoclonal Anti-CCNT2 antibody produced in mouse

SIGMA/SAB1401050 - clone 1H3, purified immunoglobulin, buffered aqueous solution

Synonym: FLJ90560; MGC134840

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-SAB1401050-100UG 100 µg
$580.00
1/EA
Add To Favorites
Western Blotting CCNT2 monoclonal antibody, clone 1H3. Western Blot analysis of CCNT2 expression in Jurkat.
Western Blotting QC Western Blot detection against Immunogen (37.51 kDa).
ELISA Detection limit for recombinant GST tagged CCNT2 is 0.3 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 1H3, monoclonal
conjugate unconjugated
form buffered aqueous solution
isotype IgG2aκ
NCBI accession no. NM_058241 
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) capture ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. O60583 
Biochem/physiol Actions: Cyclin T2 (CCNT2) is required as a cofactor and activator. It has roles in different cellular pathways such as transcriptional elongation, differentiation and apoptosis. CCNT2 phosphorylates the CTD (carboxy-terminal domain) of the large subunit of RNA polymerase II (RNAP II).
General description: The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin and its kinase partner CDK9 were found to be subunits of the transcription elongation factor p-TEFb. The p-TEFb complex containing this cyclin was reported to interact with, and act as a negative regulator of human immunodeficiency virus type 1 (HIV-1) Tat protein. Two alternatively spliced transcript variants, which encode distinct isoforms, have been described. (provided by RefSeq)
Immunogen: CCNT2 (NP_490595, 264 a.a. ~ 370 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
RKPKVDGQVSETPLLGSSLVQNSILVDSVTGVPTNPSFQKPSTSAFPAPVPLNSGNISVQDSHTSDNLSMLATGMPSTSYGLSSHQEWPQHQDSARTEQLYSQKQET
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top