Advanced Search



Monoclonal Anti-MGAT5 antibody produced in mouse

SIGMA/SAB1401244 - clone 3E9, purified immunoglobulin, buffered aqueous solution

Synonym: GNT-V; GNT-VA

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-SAB1401244-100UG 100 µg
$580.00
1/EA
Add To Favorites
Immunohistochemistry Immunoperoxidase of monoclonal antibody to MGAT5 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 μg/mL]
Western Blotting MGAT5 monoclonal antibody, clone 3E9. Western Blot analysis of MGAT5 expression in Jurkat.
Western Blotting QC Western Blot detection against Immunogen (36.52 kDa).
ELISA Detection limit for recombinant GST tagged MGAT5 is 0.1 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 3E9, monoclonal
conjugate unconjugated
form buffered aqueous solution
isotype IgG2aκ
NCBI accession no. NM_002410 
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) capture ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. Q09328 
Biochem/physiol Actions: MGAT5 (mannosyl (α-1,6-)-glycoprotein β-1,6-N-acetylglucosaminyltransferase) is involved in the biosynthesis of N-linked glycoproteins. It catalyzes the formation of β
1,6-branched N-glycans by N-acetyl-d-glucosamine transfer. MGAT5 plays a significant role in invasion and metastasis of various cancer, including glioma and hepatocellular carcinoma. It is also known to be associated with multiple sclerosis and liver fibrosis. Increased radiosensitivity of cancer cells is observed upon MGAT5 inhibition.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: This gene encodes mannosyl (alpha-1,6-)-glycoprotein beta-1,6-N-acetyl-glucosaminyltransferase, a glycosyltransferase involved in the synthesis of protein-bound and lipid-bound oligosaccharides. Alterations of the oligosaccharides on cell surface glycoproteins cause significant changes in the adhesive or migratory behavior of a cell. Increase in the encoded protein′s activity may correlate with the progression of invasive malignancies. (provided by RefSeq)
Immunogen: MGAT5 (NP_002401, 642 a.a. ~ 739 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LAEPGQSCKQVCQESQLICEPSFFQHLNKDKDMLKYKVTCQSSELAKDILVPSFDPKNKHCVFQGDLLLFSCAGAHPRHQRVCPCRDFIKGQVALCKD
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top