Advanced Search



Anti-TFAM antibody produced in mouse

SIGMA/SAB1401382 - purified immunoglobulin, buffered aqueous solution

Synonym: MtTF1; TCF6; TCF6L1; TCF6L2; TCF6L3; mtTFA

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-SAB1401382-50UG 50 µg
$580.00
1/EA
Add To Favorites
Immunohistochemistry Immunoperoxidase of antibody to TFAM on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 μg/mL]
Immunofluorescence Immunofluorescence of antibody to TFAM on HeLa cell. [antibody concentration 10 μg/mL]
Western Blotting Western Blot analysis of TFAM expression in transfected 293T cell line by TFAM polyclonal antibody. Lanes Lane 1: TFAM transfected lysate (27.06 kDa). Lane 2: Non-transfected lysate.
Western Blotting TFAM polyclonal antibody. Western Blot analysis of TFAM expression in human kidney.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone polyclonal
conjugate unconjugated
form buffered aqueous solution
NCBI accession no. NM_003201.1 
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) direct immunofluorescence: suitable
  immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
  western blot: 1 μg/mL
UniProt accession no. Q00059 
Biochem/physiol Actions: Transcription factor A, mitochondrial (TFAM) plays a vital role in transcription and replication of mammalian mitochondrial DNA (mtDNA). In addition, it is also implicated in mtDNA packaging. Polymorphism in the gene increases the risk of susceptibility to Alzheimer disease (AD). Additionally, mutation in the gene is associated with the development of mtDNA depletion syndrome.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: This gene encodes a mitochondrial transcription factor that is a key activator of mitochondrial transcription as well as a participant in mitochondrial genome replication. Studies in mice have demonstrated that this gene product is required to regulate the mitochondrial genome copy number and is essential for embryonic development. A mouse model for Kearns-Sayre syndrome was produced when expression of this gene was eliminated by targeted disruption in heart and muscle cells. (provided by RefSeq)
General description: Transcription factor A, mitochondrial (TFAM) is encoded by the gene mapped to human chromosome 10q21.1. The gene codes for a DNA binding protein characterized with HMG (high mobility group)-box domains.
Immunogen: TFAM (NP_003192.1, 1 a.a. ~ 246 a.a) full-length human protein.

Sequence
MAFLRSMWGVLSALGRSGAELCTGCGSRLRSPFSFVYLPRWFSSVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAMTKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLSDSEKELYIQHAKEDETRYHNEMKSWEEQMIEVGRKDLLRRTIKKQRKYGAEEC
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top