Monoclonal Anti-UMOD antibody produced in mouse

SIGMA/SAB1401395 - clone 3F10, purified immunoglobulin, buffered aqueous solution

Synonym: ADMCKD2; FJHN; HNFJ; MCKD2; THGP; THP

Product Type: Chemical

Catalog Number	PKG Qty.	Price


45-SAB1401395-100UG	100 µg	$580.00 1/EA	Add To Favorites

Western Blotting Western Blot analysis of UMOD expression in transfected 293T cell line by UMOD monoclonal antibody, clone 3F10. Lanes Lane 1: UMOD transfected lysate (Predicted MW: 66.7 kDa). Lane 2: Non-transfected lysate.

Western Blotting QC Western Blot detection against Immunogen (36.3 kDa).

Immunoprecipitation Immunoprecipitation of UMOD transfected lysate using anti-UMOD monoclonal antibody and Protein A Magnetic Bead , and immunoblotted with UMOD rabbit polyclonal antibody.

ELISA Detection limit for recombinant GST tagged UMOD is 0.3 ng/mL as a capture antibody.

Properties
Descriptions
Safety Info.
Basic Data

antibody form	purified immunoglobulin
antibody product type	primary antibodies
biological source	mouse
clone	3F10, monoclonal
conjugate	unconjugated
form	buffered aqueous solution
isotype	IgG2bκ
NCBI accession no.	NM_001008389
Quality Level	100
shipped in	dry ice
species reactivity	human
storage temp.	−20°C
target post-translational modification	unmodified
technique(s)	capture ELISA: suitable
	immunoprecipitation (IP): suitable
	western blot: 1-5 μg/mL
UniProt accession no.	P07911

General description:	This gene encodes uromodulin, the most abundant protein in normal urine. Its excretion in urine follows proteolytic cleavage of the ectodomain of its glycosyl phosphatidylinosital-anchored counterpart that is situated on the luminal cell surface of the loop of Henle. Uromodulin may act as a constitutive inhibitor of calcium crystallization in renal fluids. Excretion of uromodulin in urine may provide defense against urinary tract infections caused by uropathogenic bacteria. Defects in this gene are associated with the autosomal dominant renal disorders medullary cystic kidney disease-2 (MCKD2) and familial juvenile hyperuricemic nephropathy (FJHN). These disorders are characterized by juvenile onset of hyperuricemia, gout, and progressive renal failure. While several transcript variants may exist for this gene, the full-length natures of only two have been described to date. These two represent the major variants of this gene and encode the same isoform. (provided by RefSeq)
Immunogen:	UMOD (NP_001008390.1, 25 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence DTSEARWCSECHSNATCTEDEAVTTCTCQEGFTGDGLTCVDLDECAIPGAHNCSANSSCVNTPGSFSCVCPEGFRLSPGLGCTDVDECAEPGLSHC
Physical form:	Solution in phosphate buffered saline, pH 7.4

RIDADR	NONH for all modes of transport
Flash Point(F)	Not applicable
Flash Point(C)	Not applicable

Storage Temp.	−20°C
UNSPSC	12352203

To Order From a Quote