Advanced Search



Monoclonal Anti-LHX5 antibody produced in mouse

SIGMA/SAB1401798 - clone 1D9, ascites fluid

Synonym: MGC129689

MDL Number: MFCD03096991
Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-SAB1401798-200UL 200 µL
$580.00
1/EA
Add To Favorites
Immunoblotting Monoclonal Anti-LHX5, antibody produced in mouse, clone 1D9, ascites fluid: Cat. No. SAB1401798: Antibody concentration: 1.0 μg/mL. Specific band of ~37.11 kDa using immunogen protein lysate.
Western Blotting QC Western Blot detection against Immunogen (36.74 kDa).

 

antibody form ascites fluid
antibody product type primary antibodies
biological source mouse
clone 1D9, monoclonal
conjugate unconjugated
isotype IgG2aκ
NCBI accession no. NM_022363 
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) capture ELISA: suitable
  western blot: 1:500-1:1000
UniProt accession no. Q9H2C1 
General description: This gene encodes a protein belonging to a large protein family, members of which carry the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein may function as a transcriptional regulator and be involved in the control of differentiation and development of the forebrain. In mice, this protein is essential for the regulation of precursor cell proliferation and the control of neuronal differentiation and migration during hippocampal development. This protein is involved in learning and motor functions in adult mice. (provided by RefSeq)
Immunogen: LHX5 (NP_071758, 136 a.a. ~ 235 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
CTDRSLSPDLQDALQDDPKETDNSTSSDKETANNENEEQNSGTKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKE
Physical form: Clear solution
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top