Advanced Search



Monoclonal Anti-SLC13A5 antibody produced in mouse

SIGMA/SAB1402084 - clone 2G4, purified immunoglobulin, buffered aqueous solution

Synonym: DKFZp686E17257; MGC138356; NACT

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-SAB1402084-100UG 100 µg
$614.00
1/EA
Add To Favorites
Immunohistochemistry Immunoperoxidase of monoclonal antibody to SLC13A5 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 μg/mL]
Western Blotting SLC13A5 monoclonal antibody, clone 2G4. Western Blot analysis of SLC13A5 expression in HepG2.
Western Blotting QC Western Blot detection against Immunogen (31.79 kDa).
ELISA Detection limit for recombinant GST tagged SLC13A5 is 0.03 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 2G4, monoclonal
conjugate unconjugated
form buffered aqueous solution
isotype IgG1κ
NCBI accession no. NM_177550 
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) capture ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. Q86YT5 
Biochem/physiol Actions: SLC13A5 (solute carrier family 13 member 5) is a sodium-coupled citrate transporter. Its function involves the transportation of citrate from the bloodstream into the liver. The expression of the gene is found to be increased in obesity and non-alcoholic fatty liver disease. Downregulation of SLC13A5 promotes AMPK (adenosine monophosphate-activated protein kinase) activation and inhibits ACLY (ATP citrate lyase) expression. SLC13A5 is thus found to regulate homeostasis of energy and lipid in liver cancer, as the gene is associated with synthesis of fatty acids and cholesterol. Mutation in the SLC13A5 gene leads to early occurrence of epilepsy, developmental delay and tooth dysplasia in children.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: The solute carrier family 13 member 5 (SLC13A5) gene is mapped to human chromosome 17p13.1. It is highly expressed in the plasma membrane of hepatocytes and is also expressed in the cells of testis and brain.
Immunogen: SLC13A5 (NP_808218, 152 a.a. ~ 206 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
VEAILQQMEATSAATEAGLELVDKGKAKELPGSQVIFEGPTLGQQEDQERKRLCK
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top