Advanced Search



Monoclonal Anti-ATP6V1A, (C-terminal) antibody produced in mouse

SIGMA/SAB1402125 - clone 4F5, purified immunoglobulin, buffered aqueous solution

Synonym: ATP6A1; ATP6V1A1; HO68; VA68; VPP2; Vma1

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-SAB1402125-100UG 100 µg
$580.00
1/EA
Add To Favorites
Immunohistochemistry Immunoperoxidase of monoclonal antibody to ATP6V1A on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 μg/mL]
Immunofluorescence Immunofluorescence of monoclonal antibody to ATP6V1A on HeLa cell. [antibody concentration 10 μg/mL]
Western Blotting ATP6V1A monoclonal antibody, clone 4F5. Western Blot analysis of ATP6V1A expression in human kidney.
Western Blotting Western Blot analysis of ATP6V1A expression in transfected 293T cell line by ATP6V1A monoclonal antibody, clone 4F5. Lanes Lane 1: ATP6V1A transfected lysate (Predicted MW: 68.3 kDa). Lane 2: Non-transfected lysate.
Western Blotting QC Western Blot detection against Immunogen (37.84 kDa).
ELISA Detection limit for recombinant GST tagged ATP6V1A is 0.03 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 4F5, monoclonal
conjugate unconjugated
form buffered aqueous solution
isotype IgG1κ
mol wt antigen ~38.21 kDa
NCBI accession no. NM_001690 
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunofluorescence: suitable
  immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
  indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. P38606 
Biochem/physiol Actions: The vacuolar-ATPases significantly control the internal pH by maintaining it neutral. ATP6V1A (ATPase H+ transporting V1 subunit A) is known to be associated with the acidification and intracellular trafficking of secretory granules, endosomes, and lysosomes. Mutations in the gene affect the structure and organisation of V-ATPase, glycosylation of proteins, Golgi trafficking. Mutations can also affect the lysosomal function and results in abnormal extracellular matrix homeostasis. ATP6V1A might serve as a prognostic factor in gastric cancer.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c′, c", and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This encoded protein is one of two V1 domain A subunit isoforms and is found in all tissues. Transcript variants derived from alternative polyadenylation exist. (provided by RefSeq)
Immunogen: ATP6V1A (NP_001681, 508 a.a. ~ 617 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
TLEVAKLIKDDFLQQNGYTPYDRFCPFYKTVGMLSNMIAFYDMARRAVETTAQSDNKITWSIIREHMGDILYKLSSMKFKDPLKDGEAKIKSDYAQLLEDMQNAFRSLED
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
WGK Germany WGK 1
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top