Monoclonal Anti-DIO1 antibody produced in mouse

SIGMA/SAB1402173 - clone 1E4, purified immunoglobulin, buffered aqueous solution

Synonym: 5DI; MGC130050; MGC130051; TXDI1

Product Type: Chemical

Catalog Number	PKG Qty.	Price	Quantity


45-SAB1402173-100UG	100 µg	$580.00 1/EA		Add To Favorites

This image is provided for informative purposes only and does not represent an actual product label. It should not be used as a substitute for official product labeling.

Properties
Descriptions
Safety Info.
Basic Data

antibody form	purified immunoglobulin
antibody product type	primary antibodies
biological source	mouse
clone	1E4, monoclonal
conjugate	unconjugated
form	buffered aqueous solution
isotype	IgG2aκ
mol wt	antigen ~36.12 kDa
NCBI accession no.	NM_000792
Quality Level	100
shipped in	dry ice
species reactivity	human
storage temp.	−20°C
target post-translational modification	unmodified
technique(s)	indirect ELISA: suitable
UniProt accession no.	P49895

General description:	The protein encoded by this gene is a thiol-requiring propylthiouracil-sensitive oxidoreductase. It activates thyroid hormone by converting the prohormone thyroxine (T4) by outer ring deiodination (ORD) to bioactive 3,3′,5-triiodothyronine (T3). It also degrades both hormones by inner ring deiodination (IRD). Alternative splicing results in multiple transcript variants encoding different isoforms. Some, but not all, isoforms contain a selenocysteine (Sec) residue encoded by the UGA codon, which normally signals translation termination. The 3′ UTR of Sec-containing genes have a common stem-loop structure, the sec insertion sequence (SECIS), which is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. Additional transcript variants have been described but are not supported by experimental evidence. (provided by RefSeq)
Immunogen:	DIO1 (NP_000783.2, 35 a.a. ~ 125 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence DRVKRNILAMGEKTGMTRNPHFSHDNWIPTFFSTQYFWFVLKVRWQRLEDTTELGGLAPNCPVVRLSGQRCNIWEFMQGNRPLVLNFGSCT
Physical form:	Solution in phosphate buffered saline, pH 7.4

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point(F)	Not applicable
Flash Point(C)	Not applicable

Storage Temp.	−20°C
UNSPSC	12352203

Choose a favorite list for this item:

Catalog Number	Description	Price

		$

Please choose a list :

Continue Shopping

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.