Advanced Search



Monoclonal Anti-GSTA2, (N-terminal) antibody produced in mouse

SIGMA/SAB1402215 - clone 3D4, purified immunoglobulin, buffered aqueous solution

Synonym: GST2; GSTA2-2; GTA2; GTH2; MGC10525

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-SAB1402215-100UG 100 µg
$580.00
1/EA
Add To Favorites
Immunofluorescence Immunofluorescence of monoclonal antibody to GSTA2 on HeLa cell. [antibody concentration 10 μg/mL]
Western Blotting GSTA2 monoclonal antibody, clone 3D4. Western Blot analysis of GSTA2 expression in human liver.
Western Blotting GSTA2 monoclonal antibody, clone 3D4. Western Blot analysis of GSTA2 expression in HepG2.
Western Blotting QC Western Blot detection against Immunogen (36.74 kDa).
ELISA Detection limit for recombinant GST tagged GSTA2 is 0.03 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 3D4, monoclonal
conjugate unconjugated
form buffered aqueous solution
isotype IgG1κ
mol wt antigen ~37.11 kDa
NCBI accession no. BC002895 
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunofluorescence: suitable
  indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. P09210 
General description: Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes function in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding these enzymes are known to be highly polymorphic. These genetic variations can change an individual′s susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of some drugs. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-tranferase belonging to the alpha class. The alpha class genes, located in a cluster mapped to chromosome 6, are the most abundantly expressed glutathione S-transferases in liver. In addition to metabolizing bilirubin and certain anti-cancer drugs in the liver, the alpha class of these enzymes exhibit glutathione peroxidase activity thereby protecting the cells from reactive oxygen species and the products of peroxidation. (provided by RefSeq)
Immunogen: GSTA2 (AAH02895, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MAEKPKLHYSNIRGRMESIRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKEKALIDMYIEGIA
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
WGK Germany WGK 1
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top