Advanced Search



Monoclonal Anti-HOXA6 antibody produced in mouse

SIGMA/SAB1402228 - clone 3A6, purified immunoglobulin, buffered aqueous solution

Synonym: HOX1; HOX1.2; HOX1B

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-SAB1402228-100UG 100 µg
$580.00
1/EA
Add To Favorites
Western Blotting QC Western Blot detection against Immunogen (36.74 kDa).
ELISA Detection limit for recombinant GST tagged HOXA6 is approximately 1 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 3A6, monoclonal
conjugate unconjugated
form buffered aqueous solution
isotype IgG2aκ
mol wt antigen ~37.11 kDa
NCBI accession no. NM_024014 
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) capture ELISA: suitable
  indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. P31267 
Biochem/physiol Actions: The members of HOX (Homeobox) gene family clusters with each other to form a complex. In HOXA6 (homeobox A6), there are eight homeoboxes of 90kb DNA in the cluster. It is expressed in the human adult small intestinal mucosa. It acts as transcription factors in defining gradients of cellular differentiation. It mainly functions in hemopoietic progenitor cell development, embryonic and fetal development.
General description: In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. (provided by RefSeq)
Immunogen: HOXA6 (NP_076919, 31 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
GYDALRPFPASYGASSLPDKTYTSPCFYQQSNSVLACNRASYEYGASCFYSDKDLSGASPSGSGKQRGPGDYLHFSPEQQYKPDSSSGQGKALHDEGADR
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
WGK Germany WGK 1
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top