Advanced Search



Monoclonal Anti-SLC5A3 antibody produced in mouse

SIGMA/SAB1402920 - clone 3A6, purified immunoglobulin, buffered aqueous solution

Synonym: SMIT; SMIT2

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-SAB1402920-100UG 100 µg
$580.00
1/EA
Add To Favorites
Western Blotting QC Western Blot detection against Immunogen (37.73 kDa).
ELISA Detection limit for recombinant GST tagged SLC5A3 is 0.3 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 3A6, monoclonal
conjugate unconjugated
form buffered aqueous solution
isotype IgG1κ
mol wt antigen ~38.1 kDa
NCBI accession no. NM_006933 
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) capture ELISA: suitable
  indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. P53794 
Application: Monoclonal Anti-SLC5A3 antibody produced in mouse has been used in dSTORM (direct stochastic optical reconstruction microscopy).
Biochem/physiol Actions: Solute carrier family 5 member 3 (SLC5A3) functions in cellular osmoregulation. Overexpression of SLC5A3 contributes to pathophysiology of Down syndrome. SLC5A3 acts as a transporter in hypotonic volume regulation of mammalian cells. SLC5A3 regulates millimolar intracellular concentrations of myo-inositol and promotes transepithelial myo-inositol transport in kidney, intestine, retina and choroid plexus.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: Solute carrier family 5 member 3 (SLC5A3) is a member of SLC5A gene family, which shares five transmembrane segment inverted repeats of the LeuT structural family. SLC5A3 is expressed in brain, kidney and placenta. SLC5A3 gene is located on human chromosome 21q22.11.
Immunogen: SLC5A3 (NP_008864, 533 a.a. ~ 641 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
TPPPTKEQIRTTTFWSKKNLVVKENCSPKEEPYKMQEKSILRCSENNETINHIIPNGKSEDSIKGLQPEDVNLLVTCREEGNPVASLGHSEAETPVDAYSNGQAALMGE
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
WGK Germany WGK 1
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top