Advanced Search



Monoclonal Anti-PXDN antibody produced in mouse

SIGMA/SAB1402973 - clone 2C11, purified immunoglobulin, buffered aqueous solution

Synonym: D2S448; D2S448E; KIAA0230; MG50; PRG2; PXN; VPO

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-SAB1402973-100UG 100 µg
$580.00
1/EA
Add To Favorites
Western Blotting QC Western Blot detection against Immunogen (37.84 kDa).
ELISA Detection limit for recombinant GST tagged PXDN is 0.03 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 2C11, monoclonal
conjugate unconjugated
form buffered aqueous solution
isotype IgG2bκ
mol wt antigen ~38.21 kDa
NCBI accession no. XM_056455 
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) capture ELISA: suitable
  indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. Q92626 
Biochem/physiol Actions: Peroxidasin (PXDN) releases hypobromous acid, which is involved in collagen IV reinforcement. The protein stabilizes the basement membrane by enhancing the covalent crosslinks in the collagen IV network. Mutations in the gene encoding PXDN have been linked to microphthalmia and anterior segment dysgenesis.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: Drosophila peroxidasin is an extracellular matrix-associated peroxidase (Horikoshi et al., 1999 [PubMed 10441517]). It is expressed exclusively in hemocytes derived from head mesoderm at a very early stage of differentiation. Peroxidasin exists as a homotrimer with a unique hybrid structure that combines an enzymatically functional peroxidase domain with motifs that are typically found in extracellular matrix-associated proteins. It is a secreted protein that contains a secretory recognition sequence at its N terminus. Peroxidasin catalyzes hydrogen peroxide-driven radioiodination, oxidations, and the formation of dityrosine in vitro. It is also thought to function in extracellular matrix consolidation, phagocytosis, and defense.[supplied by OMIM] Peroxidasin (PXDN) is a multidomain, glycosylated, homotrimeric peroxidase. It is expressed in the endoplasmic reticulum and secreted into the extracellular matrix. The 1479-amino acid protein belongs to the peroxidase-cyclooxygenase superfamily. It possesses a catalytic peroxidase domain (POX), a leucine-rich repeat domain (LRR), four C-like immunoglobulin domains (Ig) at the amino-terminal and a carboxy-terminal von Willebrand factor type C module (VWC). The gene encoding PXDN has 23 exons and is localized on human chromosome 2p25.3.
Immunogen: PXDN (XP_056455, 1452 a.a. ~ 1561 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
STSAFSTRSDASGTNDFREFVLEMQKTITDLRTQIKKLESRLSTTECVDAGGESHANNTKWKKDACTICECKDGQVTCFVEACPPATCAVPVNIPGACCPVCLQKRAEEK
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
WGK Germany WGK 1
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top