Advanced Search



Monoclonal Anti-FCN3 antibody produced in mouse

SIGMA/SAB1402990 - clone 4B4, ascites fluid

Synonym: FCNH; HAKA1; MGC22543

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-SAB1402990-200UL 200 µL
$580.00
1/EA
Add To Favorites
Western Blotting Western Blot analysis of FCN3 expression in transfected 293T cell line by FCN3 monoclonal antibody, clone 4B4. Lanes Lane 1: FCN3 transfected lysate (31.7 kDa). Lane 2: Non-transfected lysate.
Western Blotting QC Western Blot detection against Immunogen (57.42 kDa).
Immunoprecipitation Immunoprecipitation of FCN3 transfected lysate using anti-FCN3 monoclonal antibody and Protein A Magnetic Bead , and immunoblotted with FCN3 rabbit polyclonal antibody.

 

antibody form ascites fluid
antibody product type primary antibodies
biological source mouse
clone 4B4, monoclonal
conjugate unconjugated
isotype IgMκ
mol wt antigen ~57.79 kDa
NCBI accession no. BC020731 
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunoprecipitation (IP): suitable
  indirect ELISA: suitable
  western blot: 1:500-1:1000
UniProt accession no. O75636 
General description: Ficolins are a group of proteins which consist of a collagen-like domain and a fibrinogen-like domain. In human serum, there are two types of ficolins, both of which have lectin activity. The protein encoded by this gene is a thermolabile beta-2-macroglycoprotein found in all human serum and is a member of the ficolin/opsonin p35 lectin family. The protein, which was initially identified based on its reactivity with sera from patients with systemic lupus erythematosus, has been shown to have a calcium-independent lectin activity. The protein can activate the complement pathway in association with MASPs and sMAP, thereby aiding in host defense through the activation of the lectin pathway. Alternative splicing occurs at this locus and two variants, each encoding a distinct isoform, have been identified. (provided by RefSeq)
Immunogen: FCN3 (AAH20731, 1 a.a. ~ 288 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MDLLWILPSLWLLLLGGPACLKTQEHPSCPGPRELEASKVVLLPSCPGAPGSPGEKGAPGPQGPPGPPGKMGPKGEPGPRNCRELLSQGATLSGWYHLCLPEGRALPVFCDMDTEGGGWLVFQRRQDGSVDFFRSWSSYRAGFGNQESEFWLGNENLHQLTLQGNWELRVELEDFNGNRTFAHYATFRLLGEVDHYQLALGKFSEGTAGDSLSLHSGRPLTTYDADHDSSNSNCAVIVHGAWWYASCYRSNLNGRYAVSEAAAHKYGIDWASGRGVGHPYRRVRMMLR
Physical form: Clear solution
RIDADR NONH for all modes of transport
WGK Germany WGK 1
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top