Advanced Search



Monoclonal Anti-DYNLL1, (N-terminal) antibody produced in mouse

SIGMA/SAB1402996 - clone 1H7, purified immunoglobulin, buffered aqueous solution

Synonym: DLC1; DLC8; DNCL1; DNCLC1; LC8; LC8a; MGC126137; MGC126138; PIN

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-SAB1402996-100UG 100 µg
$580.00
1/EA
Add To Favorites
Immunofluorescence Immunofluorescence of monoclonal antibody to DYNLL1 on HeLa cell. [antibody concentration 10 μg/mL]
Western Blotting Western Blot analysis of DYNLL1 expression in transfected 293T cell line by DYNLL1 monoclonal antibody, clone 1H7. Lanes Lane 1: DYNLL1 transfected lysate (10.4 kDa). Lane 2: Non-transfected lysate.
Western Blotting QC Western Blot detection against Immunogen (33.66 kDa).
ELISA Detection limit for recombinant GST tagged DYNLL1 is 0.1 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 1H7, monoclonal
conjugate unconjugated
form buffered aqueous solution
isotype IgG2aκ
mol wt antigen ~34.03 kDa
NCBI accession no. NM_003746 
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) capture ELISA: suitable
  immunofluorescence: suitable
  indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. P63167 
General description: Cytoplasmic dyneins are large enzyme complexes with a molecular mass of about 1,200 kD. They contain two force-producing heads formed primarily from dynein heavy chains, and stalks linking the heads to a basal domain, which contains a varying number of accessory intermediate chains. The complex is involved in intracellular transport and motility. The protein described in this record is a light chain and exists as part of this complex but also physically interacts with and inhibits the activity of neuronal nitric oxide synthase. Binding of this protein destabilizes the neuronal nitric oxide synthase dimer, a conformation necessary for activity, and it may regulate numerous biologic processes through its effects on nitric oxide synthase activity. Alternate transcriptional splice variants have been characterized. (provided by RefSeq)
Immunogen: DYNLL1 (NP_003737.1, 1 a.a. ~ 72 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKH
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
WGK Germany WGK 1
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top