Advanced Search



Monoclonal Anti-KIAA1199 antibody produced in mouse

SIGMA/SAB1403322 - clone 3C12, purified immunoglobulin, buffered aqueous solution

Synonym: TMEM2L

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-SAB1403322-100UG 100 µg
$580.00
1/EA
Add To Favorites
Western Blotting Western Blot analysis of KIAA1199 expression in transfected 293T cell line by KIAA1199 monoclonal antibody, clone 3C12. Lanes Lane 1: KIAA1199 transfected lysate (110.4 kDa). Lane 2: Non-transfected lysate.
Western Blotting QC Western Blot detection against Immunogen (36.74 kDa).
Immunoprecipitation Immunoprecipitation of KIAA1199 transfected lysate using anti-KIAA1199 monoclonal antibody and Protein A Magnetic Bead , and immunoblotted with KIAA1199 rabbit polyclonal antibody.
ELISA Detection limit for recombinant GST tagged KIAA1199 is 0.1 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 3C12, monoclonal
conjugate unconjugated
form buffered aqueous solution
isotype IgG2aκ
mol wt antigen ~37.11 kDa
NCBI accession no. NM_018689 
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) capture ELISA: suitable
  immunoprecipitation (IP): suitable
  indirect ELISA: suitable
  western blot: 1-5 μg/mL
Application: Monoclonal Anti-KIAA1199 antibody produced in mouse is suitable for capture ELISA, indirect ELISA and western blot applications.
Biochem/physiol Actions: KIAA1199 performs in cell signaling, adhesion, migration and proliferation in human cancers. In colon cancer, it is highly expressed in several cells including cytoplasm, perinuclear space and the cell membrane of adenocarcinomas and cochlea. It mediates hyaluronan (HA) depolymerization in an acidic cellular microenvironment such as clathrin-coated vesicles or early endosomes. In addition, it is also associated with the protein binding, transport, and folding; and Ca2+, G-protein, ephrin, and Wnt signaling. It has been reported that KIAA1199 may negatively regulate the Wnt/CTNNB1 signaling pathway.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: KIAA1199 is an endonuclear protein secreted into the extracellular environment. It encodes a 150kDa, inner ear-specific protein consisting of three domains and an N-terminal secretion signal. It is expressed in the inner ear.
General description: Mouse monoclonal antibody raised against a partial recombinant KIAA1199.
Immunogen: KIAA1199 (NP_061159.1, 880 a.a. ~ 979 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LYDGPINIQNCTFRKFVALEGRHTSALAFRLNNAWQSCPHNNVTGIAFEDVPITSRVFFGEPGPWFNQLDMDGDKTSVFHDVDGSVSEYPGSYLTKNDNW
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
WGK Germany WGK 1
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top