Advanced Search



Monoclonal Anti-TNRC6C antibody produced in mouse

SIGMA/SAB1403333 - clone 3G11, purified immunoglobulin, buffered aqueous solution

Synonym: FLJ20015; KIAA1582

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-SAB1403333-100UG 100 µg
$580.00
1/EA
Add To Favorites
Immunofluorescence Immunofluorescence of monoclonal antibody to TNRC6C on HeLa cell. [antibody concentration 10 μg/mL]

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 3G11, monoclonal
conjugate unconjugated
form buffered aqueous solution
isotype IgG2aκ
mol wt antigen ~36.89 kDa
NCBI accession no. NM_018996 
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunofluorescence: suitable
  indirect ELISA: suitable
UniProt accession no. Q9HCJ0 
Application: Monoclonal Anti-TNRC6C antibody produced mouse is suitable for indirect ELISA.
Biochem/physiol Actions: TNRC6C (Trinucleotide repeat containing 6C) plays an important role in the microRNA repression during protein synthesis via miRNA pathway. The C-terminal RRM RNA-binding domain mediates the process of translational repression. Its GW-rich and Q-rich domain also suppress the expression for protein synthesis by binding to a reporter mRNA. In addition to translational repression, the members of the GW182 family, also participate in the deadenylation and decay of miRNA by interacting with argonaute proteins.
General description: Mouse monoclonal antibody raised against a partial recombinant TNRC6C.
General description: TNRC6C (Trinucleotide repeat containing 6C) is a member of GW182 (Gly-Trp) family consisting of a domain similar to Drosophila GW182 (also known as Gawky), a domain rich in GW or WG repeats followed by a glutamine (Q)-rich region at the N-proximal end, a central ubiquitin-associated (UBA) domain and an RNA-binding domain termed as RRM.
Immunogen: TNRC6C (NP_061869, 181 a.a. ~ 280 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
TDGPNNTNPMNSSPNPINAMQTNGLPNWGMAVGMGAIIPPHLQGLPGANGSSVSQVSGGSAEGISNSVWGLSPGNPATGNSNSGFSQGNGDTVNSALSAK
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
WGK Germany WGK 1
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top