Advanced Search



Monoclonal Anti-RPS6KB1, (C-terminal) antibody produced in mouse

SIGMA/SAB1404335 - clone 1E10, purified immunoglobulin, buffered aqueous solution

Synonym: PS6K; S6K; S6K1; STK14A; p70(S6K)-alpha; p70-S6K; p70-alpha

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-SAB1404335-100UG 100 µg
$580.00
1/EA
Add To Favorites
Immunofluorescence Immunofluorescence of monoclonal antibody to RPS6KB1 on HeLa cell. [antibody concentration 60 μg/mL]
Proximity Ligation Assay Proximity Ligation Analysis of protein-protein interactions between STK11 and RPS6KB1. HeLa cells were stained with anti-STK11 rabbit purified polyclonal 1:1200 and anti-RPS6KB1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Western Blotting RPS6KB1 monoclonal antibody, clone 1E10 Western Blot analysis of RPS6KB1 expression in HeLa.
Western Blotting QC Western Blot detection against Immunogen (37.84 kDa).
ELISA Detection limit for recombinant GST tagged RPS6KB1 is approximately 0.03 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 1E10, monoclonal
conjugate unconjugated
form buffered aqueous solution
isotype IgG
mol wt antigen ~38.21 kDa
NCBI accession no. NM_003161 
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) capture ELISA: suitable
  indirect ELISA: suitable
  indirect immunofluorescence: suitable
  proximity ligation assay: suitable
  western blot: 1-5 μg/mL
UniProt accession no. P23443 
General description: This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 non-identical kinase catalytic domains and phosphorylates several residues of the S6 ribosomal protein. The kinase activity of this protein leads to an increase in protein synthesis and cell proliferation. Amplification of the region of DNA encoding this gene and overexpression of this kinase are seen in some breast cancer cell lines. Alternate translational start sites have been described and alternate transcriptional splice variants have been observed but have not been thoroughly characterized. (provided by RefSeq)
Immunogen: RPS6KB1 (NP_003152, 416 a.a. ~ 525 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PSVLESVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSGIEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
WGK Germany WGK 1
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top