Advanced Search



Monoclonal Anti-RIPK2, (C-terminal) antibody produced in mouse

SIGMA/SAB1404621 - clone 6F7, purified immunoglobulin, buffered aqueous solution

Synonym: CARD3; CARDIAK; CCK; GIG30; RICK; RIP2

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-SAB1404621-100UG 100 µg
$580.00
1/EA
Add To Favorites
Immunohistochemistry Immunoperoxidase of monoclonal antibody to RIPK2 on formalin-fixed paraffin-embedded human prostate. [antibody concentration 1.2 μg/mL]
Western Blotting RIPK2 monoclonal antibody, clone 6F7 Western Blot analysis of RIPK2 expression in HeLa.
Western Blotting RIPK2 monoclonal antibody, clone 6F7. Western Blot analysis of RIPK2 expression in PC-12.
Western Blotting RIPK2 monoclonal antibody, clone 6F7. Western Blot analysis of RIPK2 expression in NIH/3T3.
Western Blotting RIPK2 monoclonal antibody, clone 6F7. Western Blot analysis of RIPK2 expression in Raw 264.7.
Western Blotting Western Blot analysis of RIPK2 expression in transfected 293T cell line by RIPK2 monoclonal antibody, clone 6F7. Lanes Lane 1: RIPK2 transfected lysate (61.2 kDa). Lane 2: Non-transfected lysate.
Western Blotting QC Western Blot detection against Immunogen (37.84 kDa).
ELISA Detection limit for recombinant GST tagged RIPK2 is approximately 0.1 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 6F7, monoclonal
conjugate unconjugated
form buffered aqueous solution
isotype IgG2aκ
mol wt antigen ~38.21 kDa
NCBI accession no. BC004553 
Quality Level 100 
shipped in dry ice
species reactivity mouse, human, rat
storage temp. −20°C
target post-translational modification unmodified
technique(s) capture ELISA: suitable
  immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
  indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. O43353 
Application: Monoclonal Anti-RIPK2, (C-terminal) antibody produced in mouse has been used in immunoblotting (1:500).
Biochem/physiol Actions: Receptor interacting serine/threonine kinase 2 (RIPK2) is a key regulator of the immune and inflammatory pathways. It is a potent activator of nuclear factor (NF)-κB via nucleotide-binding and oligomerization domain (NOD) receptor. RIPK2 is associated with the progression and aggressiveness, tumor size, metastasis, and overall stagging in various types of cancers. Overexpression of RIPK2 is observed in the head and neck squamous cell carcinoma (HNSCC), gastric cancer, colorectal cancer (CRC), and lethal prostate cancers. It is found to induce cell proliferation and inhibit apoptosis in glioma and breast cancer. RIPK2 polymorphism is also associated with the onset of bladder cancer.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: Receptor interacting serine/threonine kinase 2 (RIPK2) belongs to the RIP kinase family. The protein contains a caspase activation and recruitment domain (CARD) at the C-terminal, N-terminal kinase domain, and a bridging intermediate domain. The gene is mapped to human chromosome 8q21.3.
General description: This gene encodes a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases. The encoded protein contains a C-terminal caspase activation and recruitment domain (CARD), and is a component of signaling complexes in both the innate and adaptive immune pathways. It is a potent activator of NF-kappaB and inducer of apoptosis in response to various stimuli. (provided by RefSeq)
Immunogen: RIPK2 (AAH04553, 431 a.a. ~ 540 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LQPGIAQQWIQSKREDIVNQMTEACLNQSLDALLSRDLIMKEDYELVSTKPTRTSKVRQLLDTTDIQGEEFAKVIVQKLKDNKQMGLQPYPEILVVSRSPSLNLLQNKSM
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
WGK Germany WGK 1
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top