Advanced Search



Monoclonal Anti-MAPKAPK2 antibody produced in mouse

SIGMA/SAB1404696 - clone 3B8, purified immunoglobulin, buffered aqueous solution

Synonym: MK2

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-SAB1404696-100UG 100 µg
$580.00
1/EA
Add To Favorites
Immunohistochemistry Immunoperoxidase of monoclonal antibody to MAPKAPK2 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 μg/mL]
Western Blotting MAPKAPK2 monoclonal antibody, clone 3B8. Western Blot analysis of MAPKAPK2 expression in PC-12.
Western Blotting MAPKAPK2 monoclonal antibody, clone 3B8 Western Blot analysis of MAPKAPK2 expression in Jurkat.
Western Blotting MAPKAPK2 monoclonal antibody, clone 3B8. Western Blot analysis of MAPKAPK2 expression in NIH/3T3.
Western Blotting QC Western Blot detection against Immunogen (35.57 kDa).

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 3B8, monoclonal
conjugate unconjugated
form buffered aqueous solution
isotype IgG2aκ
mol wt antigen ~35.57 kDa
NCBI accession no. NM_032960 
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
  indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. P49137 
Biochem/physiol Actions: Mitogen-activated protein kinase-activated protein kinase 2 (MAPKAPK2) is involved in cytokine production and cell migration. Overexpression of MAPKAPK2 confers multiple myeloma (MM) resistance to chemotherapy. It phosphorylates the proteins found in the nucleus and cytoplasm. This protein confers gemcitabine sensitivity in pancreatic cancer cells. The protein is required for tumor necrosis factor (TNF) biosynthesis. It is linked to tumorigenesis and drug resistance. The protein functions as a prognostic marker for lung cancer.
General description: Mitogen-activated protein kinase-activated protein kinase 2 (MAPKAPK2) gene encodes a member of the Ser/Thr protein kinase family. This kinase is regulated through direct phosphorylation by p38 MAP kinase. In conjunction with p38 MAP kinase, this kinase is known to be involved in many cellular processes including stress and inflammatory responses, nuclear export, gene expression regulation and cell proliferation. Heat shock protein HSP27 was shown to be one of the substrates of this kinase in vivo. Two transcript variants encoding two different isoforms have been found for this gene. (provided by RefSeq)The gene is located on human chromosome 1q32.1. It consists of an autoinhibitory domain, a helix-turn-helix structure, which occupies the substrate binding cleft of the kinase domain and inhibits kinase function.
Immunogen: MAPKAPK2 (NP_116584, 266 a.a. ~ 352 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
NHGLAISPGMKTRIRMGQYEFPNPEWSEVSEEVKMLIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDV
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
WGK Germany WGK 1
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top