Advanced Search



Monoclonal Anti-RNPS1 antibody produced in mouse

SIGMA/SAB1404879 - clone 7G8, purified immunoglobulin, buffered aqueous solution

Synonym: E5.1; MGC117332

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-SAB1404879-100UG 100 µg
$580.00
1/EA
Add To Favorites
Western Blotting RNPS1 monoclonal antibody, clone 7G8. Western Blot analysis of RNPS1 expression in PC-12.
Western Blotting RNPS1 monoclonal antibody, clone 7G8. Western Blot analysis of RNPS1 expression in Raw 264.7.
Western Blotting RNPS1 monoclonal antibody, clone 7G8. Western Blot analysis of RNPS1 expression in 293.
Western Blotting RNPS1 monoclonal antibody, clone 7G8. Western Blot analysis of RNPS1 expression in HeLa.
Western Blotting RNPS1 monoclonal antibody, clone 7G8. Western Blot analysis of RNPS1 expression in human kidney.
Western Blotting RNPS1 monoclonal antibody, clone 7G8. Western Blot analysis of RNPS1 expression in rat testis.
Western Blotting QC Western Blot detection against Immunogen (34.76 kDa).

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 7G8, monoclonal
conjugate unconjugated
form buffered aqueous solution
isotype IgG2aκ
mol wt antigen ~35.13 kDa
NCBI accession no. NM_006711 
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. Q15287 
General description: This gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. This protein binds to the mRNA and remains bound after nuclear export, acting as a nucleocytoplasmic shuttling protein. This protein contains many serine residues. Two splice variants have been found for this gene; both variants encode the same protein. (provided by RefSeq)
Immunogen: RNPS1 (NP_006702, 158 a.a. ~ 239 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PKPTKVHIGRLTRNVTKDHIMEIFSTYGKIKMIDMPVERMHPHLSKGYAYVEFENPDEAEKALKHMDGGQIDGQEITATAVL
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
WGK Germany WGK 1
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top