Advanced Search



Monoclonal Anti-RRAS2 antibody produced in mouse

SIGMA/SAB1404934 - clone 2D3-4B8, ascites fluid

Synonym: TC21

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-SAB1404934-200UL 200 µL
$580.00
1/EA
Add To Favorites
Western Blotting Western Blot analysis of RRAS2 expression in transfected 293T cell line by RRAS2 monoclonal antibody, clone 2D3-4B8. Lanes Lane 1: RRAS2 transfected lysate (Predicted MW: 23.4 kDa). Lane 2: Non-transfected lysate.
Western Blotting RRAS2 monoclonal antibody, clone 2D3-4B8 Western Blot analysis of RRAS2 expression in A-431.
Western Blotting RRAS2 monoclonal antibody, clone 2D3-4B8. Western Blot analysis of RRAS2 expression in HeLa.
Western Blotting QC Western Blot detection against Immunogen (48.18 kDa).

 

antibody form ascites fluid
antibody product type primary antibodies
biological source mouse
clone 2D3-4B8, monoclonal
conjugate unconjugated
isotype IgG2aκ
mol wt antigen ~48.55 kDa
NCBI accession no. BC013106 
Quality Level 100 
shipped in dry ice
species reactivity rat, mouse, human
storage temp. −20°C
target post-translational modification unmodified
technique(s) indirect ELISA: suitable
  western blot: 1:500-1:1000
UniProt accession no. P62070 
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen: RRAS2 (AAH13106, 1 a.a. ~ 204 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHCVIF
Physical form: Clear solution
RIDADR NONH for all modes of transport
WGK Germany WGK 1
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top