Advanced Search



Anti-MCHR1 antibody produced in rabbit

SIGMA/SAB1408582 - purified immunoglobulin, buffered aqueous solution

Synonym: GPR24; MCH1R; MGC32129; SLC1

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-SAB1408582-100UG 100 µg
$580.00
1/EA
Add To Favorites
Western Blotting MCHR1 rabbit polyclonal antibody. Western Blot analysis of MCHR1 expression in IMR-32.
Western Blotting Western Blot analysis of MCHR1 expression in transfected 293T cell line by MCHR1 polyclonal antibody. Lanes Lane 1: MCHR1 transfected lysate (46.00 kDa). Lane 2: Non-transfected lysate.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source rabbit
clone polyclonal
conjugate unconjugated
form buffered aqueous solution
mol wt antigen ~46 kDa
NCBI accession no. BC021146 
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) western blot: 1 μg/mL
UniProt accession no. Q99705 
Application: Anti-MCHR1 antibody produced in rabbit is suitable for western blot analysis.
Biochem/physiol Actions: MCHR1 (melanin-concentrating hormone receptor 1) is involved in various biological processes such as in regulation of energy balance, food intake, physical activity and body weight. It is majorly associated with the neurotransmitter and neuropeptide systems, which are a part of regulation of food intake and energy balance. It forms complex with G proteins to inhibit adenylyl cyclase and with G proteins that activate phosphoinositide hydrolysis. The gene is associated with the schizophrenia disease since it has influence on schizophrenia susceptibility. It mediates Gα(i)-dependent signaling pathway. It has also been reported that MCHR1 regulates the orexigenic activity of melanin-concentrating hormone (MCH).
General description: The protein encoded by this gene, a member of the G protein-coupled receptor family 1, is an integral plasma membrane protein which binds melanin-concentrating hormone. The encoded protein can inhibit cAMP accumulation and stimulate intracellular calcium flux, and is probably involved in the neuronal regulation of food consumption. Although structurally similar to somatostatin receptors, this protein does not seem to bind somatostatin. (provided by RefSeq)
Immunogen: MCHR1 (AAH21146.1, 1 a.a. ~ 422 a.a) full-length human protein.

Sequence
MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPDCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
WGK Germany WGK 1
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top