Advanced Search



Anti-CETN3 antibody produced in mouse

SIGMA/SAB1408788 - purified immunoglobulin, buffered aqueous solution

Synonym: CEN3; MGC12502; MGC138245

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-SAB1408788-50UG 50 µg
$580.00
1/EA
Add To Favorites
Immunofluorescence Immunofluorescence of antibody to CETN3 on HeLa cell. [antibody concentration 10 μg/mL]
Western Blotting Western Blot analysis of CETN3 expression in transfected 293T cell line by CETN3 polyclonal antibody. Lanes Lane 1: CETN3 transfected lysate (19.50 kDa). Lane 2: Non-transfected lysate.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone polyclonal
conjugate unconjugated
form buffered aqueous solution
mol wt antigen 19.5 kDa
NCBI accession no. NM_004365 
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunofluorescence: suitable
  western blot: 1 μg/mL
UniProt accession no. O15182 
General description: The protein encoded by this gene contains four EF-hand calcium binding domains, and is a member of the centrin protein family. Centrins are evolutionarily conserved proteins similar to the CDC31 protein of S. cerevisiae. Yeast CDC31 is located at the centrosome of interphase and mitotic cells, where it plays a fundamental role in centrosome duplication and separation. Multiple forms of the proteins similar to the yeast centrin have been identified in human and other mammalian cells, some of which have been shown to be associated with centrosome fractions. This protein appears to be one of the most abundant centrins associated with centrosome, which suggests a similar function to its yeast counterpart. (provided by RefSeq)
Immunogen: CETN3 (NP_004356.2, 1 a.a. ~ 167 a.a) full-length human protein.

Sequence
MSLALRSELVVDKTKRKKRRELSEEQKQEIKDAFELFDTDKDEAIDYHELKVAMRALGFDVKKADVLKILKDYDREATGKITFEDFNEVVTDWILERDPHEEILKAFKLFDDDDSGKISLRNLRRVARELGENMSDEELRAMIEEFDKDGDGEINQEEFIAIMTGDI
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top