Advanced Search



Anti-S100A10 antibody produced in mouse

SIGMA/SAB1409624 - purified immunoglobulin, buffered aqueous solution

Synonym: 42C; ANX2L; ANX2LG; CAL1L; CLP11; Ca[1]; GP11; MGC111133; P11

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-SAB1409624-50UG 50 µg
$580.00
1/EA
Add To Favorites
Immunofluorescence Immunofluorescence of antibody to S100A10 on HeLa cell. [antibody concentration 10 μg/mL]
Western Blotting S100A10 polyclonal antibody. Western Blot analysis of S100A10 expression in human lung cancer.
Western Blotting Western Blot analysis of S100A10 expression in transfected 293T cell line by S100A10 polyclonal antibody. Lane1:S100A10 transfected lysate (10.78 kDa). Lane 2:Non-transfected lysate.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone polyclonal
conjugate unconjugated
form buffered aqueous solution
mol wt antigen 10.78 kDa
NCBI accession no. BC015973 
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunofluorescence: suitable
  western blot: 1 μg/mL
UniProt accession no. P60903 
General description: The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in exocytosis and endocytosis. (provided by RefSeq)
Immunogen: S100A10 (AAH15973, 1 a.a. ~ 97 a.a) full-length human protein.

Sequence
MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top