Advanced Search



Monoclonal Anti-SMARCD2 antibody produced in mouse

SIGMA/SAB1409685 - clone 2C2, purified immunoglobulin, buffered aqueous solution

Synonym: BAF60B; CRACD2; PRO2451; Rsc6p

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-SAB1409685-100UG 100 µg
$580.00
1/EA
Add To Favorites
Western Blotting SMARCD2 monoclonal antibody, clone 2C2. Western Blot analysis of SMARCD2 expression in Raw 264.7.
Western Blotting SMARCD2 monoclonal antibody, clone 2C2. Western Blot analysis of SMARCD2 expression in PC-12.
Western Blotting SMARCD2 monoclonal antibody, clone 2C2 Western Blot analysis of SMARCD2 expression in HeLa S3 NE.
Western Blotting SMARCD2 monoclonal antibody, clone 2C2. Western Blot analysis of SMARCD2 expression in NIH/3T3.
Western Blotting QC Western Blot detection against Immunogen (34.21 kDa).

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 2C2, monoclonal
conjugate unconjugated
form buffered aqueous solution
isotype IgG2aκ
mol wt antigen 34.21 kDa
NCBI accession no. NM_003077 
Quality Level 100 
shipped in dry ice
species reactivity human, mouse, rat
storage temp. −20°C
target post-translational modification unmodified
technique(s) indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. Q92925 
General description: The protein encoded by this gene is a member of the SWI/SNF family of proteins, whose members display helicase and ATPase activities and which are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI and has sequence similarity to the yeast Swp73 protein. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. (provided by RefSeq)
Immunogen: SMARCD2 (NP_003068, 398 a.a. ~ 474 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
RDFMLSFSTDPQDFIQEWLRSQRRDLKIITDVIGNPEEERRAAFYHQPWAQEAVGRHIFAKVQQRRQELEQVLGIRL
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top