Advanced Search



Anti-CYP4V2 antibody produced in rabbit

SIGMA/SAB1410565 - purified immunoglobulin, buffered aqueous solution

Synonym: BCD; CYP4AH1; FLJ18432; MGC43534

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-SAB1410565-100UG 100 µg
$580.00
1/EA
Add To Favorites
Western Blotting Western Blot analysis of CYP4V2 expression in transfected 293T cell line by CYP4V2 polyclonal antibody. Lanes Lane 1: CYP4V2 transfected lysate (60.70 kDa). Lane 2: Non-transfected lysate.
Western Blotting CYP4V2 rabbit polyclonal antibody. Western Blot analysis of CYP4V2 expression in human kidney.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source rabbit
clone polyclonal
conjugate unconjugated
form buffered aqueous solution
mol wt antigen 60.7 kDa
NCBI accession no. NM_207352.2 
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) western blot: 1 μg/mL
UniProt accession no. Q6ZWL3 
Biochem/physiol Actions: Cytochrome P450 4V2 (CYP4V2) is involved in the fatty acid ω-hydroxylation. It alters lipid homeostasis when expressed in human liver cancer HepG2 cells. It coordinates with enzymes involved in mitochondrial and peroxisomal α/β-oxidation. Functional CYP4V2 gene mutant is implicated in ocular disease called the Bietti crystalline dystrophy. It is also expressed in macrophages and is regulated by nuclear receptor peroxisome proliferator activated receptor γ (PPARγ).
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: Cytochrome P450 4V2 (CYP4V2) belongs to human cytochrome P450 enzyme family and encodes a protein of 55 kDa. CYP4V2 gene is mapped to human chromosome 4q35.1−q35.2. CYP4V2 is majorly expressed in the epithelial cells of the retina and cornea. In retinal pigment epithelia (RPE) cell lines, the enzyme is localized to endoplasmic reticulum.
General description: This gene encodes a member of the cytochrome P450 hemethiolate protein superfamily which are involved in oxidizing various substrates in the metabolic pathway. It is implicated in the metabolism of fatty acid precursors into n-3 polyunsaturated fatty acids. Mutations in this gene result in Bietti crystalline corneoretinal dystrophy. (provided by RefSeq)
Immunogen: CYP4V2 (NP_997235.2, 1 a.a. ~ 525 a.a) full-length human protein.

Sequence
MAGLWLGLVWQKLLLWGAASALSLAGASLVLSLLQRVASYARKWQQMRPIPTVARAYPLVGHALLMKPDGREFFQQIIEYTEEYRHMPLLKLWVGPVPMVALYNAENVEVILTSSKQIDKSSMYKFLEPWLGLGLLTSTGNKWRSRRKMLTPTFHFTILEDFLDIMNEQANILVKKLEKHINQEAFNCFFYITLCALDIICETAMGKNIGAQSNDDSEYVRAVYRMSEMIFRRIKMPWLWLDLWYLMFKEGWEHKKSLKILHTFTNSVIAERANEMNANEDCRGDGRGSAPSKNKRRAFLDLLLSVTDDEGNRLSHEDIREEVDTFMFEGHDTTAAAINWSLYLLGSNPEVQKKVDHELDDVFGKSDRPATVEDLKKLRYLECVIKETLRLFPSVPLFARSVSEDCEVAGYRVLKGTEAVIIPYALHRDPRYFPNPEEFQPERFFPENAQGRHPYAYVPFSAGPRNCIGQKFAVMEEKTILSCILRHFWIESNQKREELGLEGQLILRPSNGIWIKLKRRNADER
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top