Advanced Search



Anti-XPA antibody produced in rabbit

SIGMA/SAB1411400 - purified immunoglobulin, buffered aqueous solution

Synonym: XP1; XPAC

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-SAB1411400-100UG 100 µg
$541.00
1/EA
Add To Favorites
Western Blotting XPA rabbit polyclonal antibody. Western Blot analysis of XPA expression in mouse kidney.
Western Blotting Western Blot analysis of XPA expression in transfected 293T cell line by XPA polyclonal antibody. Lanes Lane 1: XPA transfected lysate (31.40 kDa). Lane 2: Non-transfected lysate.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source rabbit
clone polyclonal
conjugate unconjugated
form buffered aqueous solution
mol wt antigen 31.4 kDa
NCBI accession no. NM_000380.2 
shipped in dry ice
species reactivity human, mouse
storage temp. −20°C
target post-translational modification unmodified
technique(s) western blot: 1 μg/mL
UniProt accession no. P23025 
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: This gene encodes a zinc finger protein involved in DNA excision repair. The encoded protein is part of the NER (nucleotide excision repair) complext which is responsible for repair of UV radiation-induced photoproducts and DNA adducts induced by chemical carcinogens. Mutations in this gene are associated with xeroderma pigmentosum complementation group A. Alternatively spliced transcript variants have been found for this gene. (provided by RefSeq)
Immunogen: XPA (NP_000371.1, 1 a.a. ~ 273 a.a) full-length human protein.

Sequence
MAAADGALPEAAALEQPAELPASVRASIERKRQRALMLRQARLAARPYSATAAAATGGMANVKAAPKIIDTGGGFILEEEEEEEQKIGKVVHQPGPVMEFDYVICEECGKEFMDSYLMNHFDLPTCDNCRDADDKHKLITKTEAKQEYLLKDCDLEKREPPLKFIVKKNPHHSQWGDMKLYLKLQIVKRSLEVWGSQEALEEAKEVRQENREKMKQKKFDKKVKELRRAVRSSVWKRETIVHQHEYGPEENLEDDMYRKTCTMCGHELTYEKM
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Tariffs & Effects on Pricing

Tariff note: As we navigate the current environment of tariff surcharges and mid-year manufacturer price increases, we want to keep you informed. While we have avoided making specific decisions thus far, we anticipate that we will be forced to implement a cost adjustment policy to offset the fees we have already been absorbing. We are committed to transparency and moderation in this process.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top