Advanced Search



Anti-RGS5 antibody produced in rabbit

SIGMA/SAB1411523 - purified immunoglobulin, buffered aqueous solution

Synonym: MST092; MST106; MST129; MSTP032; MSTP092; MSTP106; MSTP129

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-SAB1411523-100UG 100 µg
$580.00
1/EA
Add To Favorites
Western Blotting RGS5 rabbit polyclonal antibody. Western Blot analysis of RGS5 expression in human liver.
Western Blotting RGS5 rabbit polyclonal antibody. Western Blot analysis of RGS5 expression in rat brain.
Western Blotting Western Blot analysis of RGS5 expression in transfected 293T cell line by RGS5 polyclonal antibody. Lanes Lane 1: RGS5 transfected lysate (20.90 kDa). Lane 2: Non-transfected lysate.
Western Blotting RGS5 rabbit polyclonal antibody. Western Blot analysis of RGS5 expression in mouse kidney.
Western Blotting RGS5 rabbit polyclonal antibody. Western Blot analysis of RGS5 expression in human kidney.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source rabbit
clone polyclonal
conjugate unconjugated
form buffered aqueous solution
mol wt antigen 20.9 kDa
NCBI accession no. NM_003617 
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) western blot: 1 μg/mL
UniProt accession no. O15539 
General description: The regulator of G protein signaling (RGS) proteins are signal transduction molecules that have structural homology to SST2 of Saccharomyces cerevisiae and EGL-10 of Caenorhabditis elegans. Multiple genes homologous to SST2 are present in higher eukaryotes. RGS proteins are involved in the regulation of heterotrimeric G proteins by acting as GTPase activators.[supplied by OMIM
Immunogen: RGS5 (NP_003608.1, 1 a.a. ~ 181 a.a) full-length human protein.

Sequence
MCKGLAALPHSCLERAKEIKIKLGILLQKPDSVGDLVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLASFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEFYQELIK
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top