Advanced Search



Anti-CD3D antibody produced in rabbit

SIGMA/SAB1411615 - purified immunoglobulin, buffered aqueous solution

Synonym: CD3-DELTA; T3D

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-SAB1411615-100UG 100 µg
$580.00
1/EA
Add To Favorites
Proximity Ligation Assay Proximity Ligation Analysis of protein-protein interactions between CD3D and CANX. HeLa cells were stained with anti-CD3D rabbit purified polyclonal 1:1200 and anti-CANX mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Western Blotting Western Blot analysis of CD3D expression in transfected 293T cell line by CD3D polyclonal antibody. Lanes Lane 1: CD3D transfected lysate (18.90 kDa). Lane 2: Non-transfected lysate.
Western Blotting CD3D rabbit polyclonal antibody. Western Blot analysis of CD3D expression in mouse kidney.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source rabbit
clone polyclonal
conjugate unconjugated
form buffered aqueous solution
mol wt antigen 18.9 kDa
NCBI accession no. NM_000732 
Quality Level 100 
shipped in dry ice
species reactivity mouse, human
storage temp. −20°C
target post-translational modification unmodified
technique(s) proximity ligation assay: suitable
  western blot: 1 μg/mL
UniProt accession no. P04234 
General description: The protein encoded by this gene is part of the T-cell receptor/CD3 complex (TCR/CD3 complex) and is involved in T-cell development and signal transduction. The encoded membrane protein represents the delta subunit of the CD3 complex, and along with four other CD3 subunits, binds either TCR alpha/beta or TCR gamma/delta to form the TCR/CD3 complex on the surface of T-cells. Defects in this gene are a cause of severe combined immunodeficiency autosomal recessive T-cell-negative/B-cell-positive/NK-cell-positive (SCIDBNK). Two transcript variants encoding different isoforms have been found for this gene. Other variants may also exist, but the full-length natures of their transcripts has yet to be defined. (provided by RefSeq)
Immunogen: CD3D (NP_000723.1, 1 a.a. ~ 171 a.a) full-length human protein.

Sequence
MEHSTFLSGLVLATLLSQVSPFKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVAGIIVTDVIATLLLALGVFCFAGHETGRLSGAADTQALLRNDQVYQPLRDRDDAQYSHLGGNWARNK
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top